(data stored in ACNUC7421 zone)

EMBL: CP001022.PE296

CP001022.PE296       Location/Qualifiers
FT   CDS_pept        complement(315509..315694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59784"
FT                   /db_xref="GOA:B1YI00"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI00"
FT                   /protein_id="ACB59784.1"
FT                   /translation="MDMKEEKKKSKMPFFVILVIIIFVAVAAALIIYVTSEPKEETLQF
FT                   MQMTTSFVSAYLPVAS"
     atggatatga aagaggaaaa aaagaaaagc aagatgccat ttttcgtcat tctcgtcatc        60
     atcatttttg tcgccgtcgc cgctgccctg attatttatg ttacgtccga accaaaagaa       120
     gaaactcttc agttcatgca aatgacgacg agtttcgtct cggcttatct gcctgtcgca       180
     agctaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page