(data stored in ACNUC7421 zone)

EMBL: CP001022.PE297

CP001022.PE297       Location/Qualifiers
FT   CDS_pept        315853..316938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0299"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bsu:BSU09120 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59785"
FT                   /db_xref="GOA:B1YI01"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI01"
FT                   /protein_id="ACB59785.1"
FT                   /translation="MLSQFNQFLLNFSLLITSLLFAFLPLRHVKLISPASPVKLRILIG
FT                   FIAGFISVLLVLNSITYDGAKIDLRLVALVTAYYYGGWVSGGITTLSILGARFAVTPPG
FT                   AYEGLILTGLICIALLITASIYRRFASHTLKDYLVLIGIGIGYSLPALYLLTETFNRFL
FT                   EIALVYIIFILLGGYVTYSFLQELRKHFQFVQTQQELALTDGLTNLANRRKLDETLASY
FT                   DKYGFAFSVLIVDIDFFKSVNDTYGHDGGDVVLRQLSHLLEHCCPDQALVGRYGGEEFV
FT                   VLLPDTPLKDAVRLGETIRLACADQHFVFSTYPAFHVTLSIGAASSDQGETSFEVIQKA
FT                   DQSLYQAKQTGRNKVVAYSEE"
     atgttgagtc agtttaatca gtttctgtta aatttttcgt tattgatcac atcactgtta        60
     tttgcctttt taccactccg ccacgtcaaa ctcatttcac cggcgtcacc ggtcaagctt       120
     cgtatcctga tcggattcat tgccggattt atcagtgtat tacttgtcct gaacagtatt       180
     acgtatgacg gggcaaaaat tgatttacgg ctcgtcgcgc ttgtcacggc atattattat       240
     ggcggctggg tcagtggcgg gattacgaca ctctccattc tcggtgcccg gtttgcggtt       300
     acaccgcctg gggcttacga agggttgatc ctgaccggct tgatttgtat cgcgttactc       360
     atcacggcaa gtatttaccg ccgctttgcg tcgcatacat tgaaagatta tttagtcctg       420
     atcgggatcg gaattggcta cagtttaccc gccctttatc tattgacgga gacgtttaac       480
     cgatttcttg aaattgcctt ggtttatatc attttcattt tactgggcgg ttacgtcacg       540
     tacagtttcc tgcaggaatt acgcaaacac ttccaattcg tccaaaccca gcaggagctt       600
     gctttgacgg acggtctgac gaatctcgcc aaccggcgga aactcgacga gaccctagcg       660
     tcttatgaca aatatggttt tgccttttcc gtcttgatcg tcgatatcga cttttttaag       720
     tcggtcaatg atacatatgg ccatgacggg ggcgatgtcg tcttacgtca attgagccac       780
     ttgctcgaac actgttgtcc ggatcaggcg ctcgtcggca gatacggcgg ggaagagttt       840
     gtcgtcctgt taccggacac accgcttaaa gatgccgtcc ggctcggcga aacaatccgc       900
     ttggcctgtg ccgatcaaca ttttgtcttc agtacgtatc cggcattcca tgtcacgtta       960
     tcgattgggg cggcctcgtc ggaccaaggc gagacatcat ttgaagtcat ccaaaaggcc      1020
     gatcagtccc tttatcaagc aaaacagaca ggacggaata aggtcgtcgc atacagtgaa      1080
     gaataa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page