(data stored in ACNUC7421 zone)

EMBL: CP001022.PE3

CP001022.PE3         Location/Qualifiers
FT   CDS_pept        3283..3504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: lsl:LSL_0003
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59491"
FT                   /db_xref="GOA:B1YGB4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB4"
FT                   /protein_id="ACB59491.1"
FT                   /translation="MNQIKISTEYVTLGQFLKLSDIISSGGQAKPFLAEVPILVNGEVD
FT                   QRRGRKLRDGDVIDVEDYGQFIIKNEGN"
     atgaatcaaa tcaagatttc aacagaatat gtcacattag gtcagttcct gaaactttct        60
     gatatcatct cgagcggcgg acaagctaaa ccgtttctcg ccgaggtacc cattcttgtc       120
     aacggtgaag tcgatcagcg acgcggtcgt aaattacggg atggagatgt gattgacgta       180
     gaagattacg gtcagttcat cattaagaac gagggaaact aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page