(data stored in ACNUC7421 zone)

EMBL: CP001022.PE301

CP001022.PE301       Location/Qualifiers
FT   CDS_pept        complement(319302..319811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59789"
FT                   /db_xref="GOA:B1YI05"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI05"
FT                   /protein_id="ACB59789.1"
FT                   /translation="MKRLKPYRFFLTMAVLLLGLLLIDPVRGQHAARLSLKSLLDMLLL
FT                   LPPILVLVGLLDQWIKKDTLLKYMGPDAGAQGYLYILLLAAIAAGPLYVAFPVAVLLLE
FT                   KGASVRYVVFFLGAFTTVKLPVLLYEISSFGLIYTALHIGFGLLFFFMTAQLFERYQTA
FT                   LQMKSF"
     atgaaacgac tcaaaccata tcgcttcttc cttacgatgg ccgttctctt actcggactt        60
     ctgctgattg atcccgtacg cggtcagcat gccgcccggc tcagtttgaa gagtctgctt       120
     gatatgctgc ttctgttacc gccgatcctc gtcttggtcg gtctactcga tcaatggatc       180
     aaaaaagaca ccctgctgaa atacatggga ccagatgctg gggctcaagg atatctatat       240
     atcttattac tcgctgccat cgccgccggt ccgctctatg tcgctttccc cgtcgccgtc       300
     ctcctgctcg aaaaaggagc cagcgtccgg tatgtcgtct ttttcctcgg agcgttcacg       360
     acggtcaagt taccggtcct gctgtatgaa atctcttcgt ttggtcttat ctatacagca       420
     cttcacatcg gattcggtct gctgttcttt ttcatgacgg cccaactttt tgaacggtat       480
     cagaccgctt tgcagatgaa atcattttaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page