(data stored in ACNUC7421 zone)

EMBL: CP001022.PE305

CP001022.PE305       Location/Qualifiers
FT   CDS_pept        321188..321568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59793"
FT                   /db_xref="GOA:B1YI09"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI09"
FT                   /protein_id="ACB59793.1"
FT                   /translation="MKKWWIGLAVLGGYCIPFVYLALLEDFRTGTLLGYLLLLVGFTVL
FT                   AFIGQRWGHLLFVVAGNIVSYFISIYFAGRMDTFGWDGYFKPLTAEQLILLVSLLMLIP
FT                   QLIAIVVAMSLEAKKRIKKITK"
     atgaagaagt ggtggatcgg gttagctgtc ttaggcggct attgtattcc attcgtctac        60
     ctggcattgc tcgaagactt caggacaggg acattacttg gttatctact gttacttgtc       120
     ggattcacgg ttcttgcttt tatcggtcag cggtggggtc atctgctgtt tgtggttgcc       180
     ggtaatatcg tgtcttattt catatcgata tactttgcag gtcggatgga tactttcgga       240
     tgggacggtt atttcaaacc gttgacggcg gaacaactga ttctgctcgt cagtctcttg       300
     atgcttattc cacagttgat tgcgatagtg gtagcgatgt cactggaggc gaaaaagcgg       360
     ataaagaaaa taacaaagta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page