(data stored in ACNUC7421 zone)

EMBL: CP001022.PE307

CP001022.PE307       Location/Qualifiers
FT   CDS_pept        322107..322430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59795"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR038735"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI11"
FT                   /protein_id="ACB59795.1"
FT                   /translation="MPLYHKLVRDQIPTIIARNGKKATFRTLNEEEFLVEAKRKLHEEV
FT                   AEYEEATTTEEAVEELADLLELIHVLARTHGTTPEQLEAIRLKKNDKRGGFDDKLYLIE
FT                   VED"
     atgcctcttt atcataaatt agtccgggat cagattccaa ctatcattgc tcggaacgga        60
     aaaaaagcaa cattccggac ccttaacgag gaagagttcc tcgtcgaagc gaaacggaaa       120
     ttgcatgaag aagtagccga atatgaagaa gcaacgacga ctgaagaagc agttgaagaa       180
     cttgctgatt tattggaact aattcacgtg ctggctcgga cgcatggaac aacaccggaa       240
     caacttgaag caatccggct taagaaaaac gataagcgcg gtggctttga tgacaagttg       300
     tacttgattg aggtcgaaga ttga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page