(data stored in ACNUC7421 zone)

EMBL: CP001022.PE308

CP001022.PE308       Location/Qualifiers
FT   CDS_pept        322427..324751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0310"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bcy:Bcer98_0759 type III
FT                   restriction protein res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59796"
FT                   /db_xref="GOA:B1YI12"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI12"
FT                   /protein_id="ACB59796.1"
FT                   /translation="MIPAAKLTTHDLYASLVDAIDQADEVYIVAAFAQRSGVELLLPAL
FT                   RHAVERGADVHFLIGDYLHITDPEALAELLKLDGLSIRFYRSGGRAFHPKAYLFRNAET
FT                   GLSIVGSSNISKSAFRTGVEWNLHLPQAVAPHILDEAIEAFMDLYLSEAAQDLNPIVLE
FT                   AYRQEHDARQYVAEPEVDYAEQQLVMSEEILPHRVQEEALRALRETMEEGRTRALTVLA
FT                   TGLGKTYLSAFFARDFKRILFLAHQRELLEQAERSFKKVESNWQTAFYIGSDRTNDEQT
FT                   DVLFGSVQTLSQNRHLERFAQDYFDLIIIDEFHHAAAKSYQKVLAHFEPRFLLGLTATP
FT                   DRMDGADVYALCDNNVAFQMHFTSAINEGFLTPFHYYGIHDVIDYSQLRRMGRKYDAME
FT                   LEQAQIDRTVSENIYAAWSKHRQTKTIGFCSSIRQAEYLAQTFREMGHQVIALTGQTIN
FT                   RRERIQEFEQGTVEIVFTVDLFNEGVDIPKVDTLLFCRPTESIAIYTQQIGRGLRLANE
FT                   KSHCVIIDLIGNYKNVETKLMLLGTVKDKLKRGDKEPITPPKGCIIEFDTQALNIIHRM
FT                   RQPNQRKLRLIESYEQLKLDLGRRPTYIEIGQLTAVPTGYKQEWSSYVGFLKEQGELTD
FT                   EEIETYDANRELIEQVEKTVMNRSYKMVVLLAMLERGEGRWMEPITAEEVAPFFYEYLH
FT                   AEKYREVKDAQGKVFENGYNESKIVTLLKQQPFPKMVYPFETTEDQKTLYIQKDLKTTN
FT                   RILMKWITDIVHFRIESYFSS"
     ttgattccgg ccgcaaaact gacgacacac gatttgtatg cgtcgttggt cgatgccatt        60
     gaccaagcgg atgaagtcta tatcgtcgct gccttcgcgc aacgttctgg tgtcgaactg       120
     ttgttaccgg cgttacgtca cgccgtcgaa cggggcgctg atgttcattt tttgattggt       180
     gactacttac atattacgga cccggaggcg ttggcagaat tattgaaact ggacggtctg       240
     tcgatccggt tttatcgctc cggcggacgg gcgtttcatc cgaaagccta tctgttccgc       300
     aacgcagaga ccggtctgtc gattgtcggc tcatcgaata tctcaaaaag cgcttttcgg       360
     accggtgttg agtggaatct ccatttgccg caagccgtgg caccgcatat cttggatgag       420
     gcgattgagg cattcatgga tctttattta agtgaagcag cccaagacct gaatccgatt       480
     gtcctcgaag cgtaccggca agaacatgac gcacggcaat atgttgcgga accggaagtt       540
     gattatgcgg agcaacagct cgtcatgtcc gaagaaattc taccgcaccg ggtgcaggag       600
     gaagccttac gtgcactccg ggaaacgatg gaagaaggac ggacgcgtgc cttgaccgta       660
     cttgcgaccg gacttgggaa aacgtatctc agtgcgttct ttgcgcgtga ttttaaacga       720
     attctgttcc tcgcacatca acgtgagttg ctggaacaag cggaacgttc gtttaagaag       780
     gtcgaatcca attggcagac agccttttat atcggatcag accgcacgaa tgatgaacag       840
     acggacgtgc tgtttggatc agtccagacg ttatcccaaa accggcatct tgaacggttc       900
     gcacaagatt attttgattt gatcatcatc gatgagtttc accacgcagc agctaaaagc       960
     tatcaaaaag ttctggcgca tttcgaaccc cgttttttgc tcggactgac agcgacgccg      1020
     gaccggatgg acggagcgga cgtctatgca ctgtgcgaca ataatgttgc gtttcaaatg      1080
     cacttcacgt cagcgatcaa tgaaggattc ctgacaccgt tccattatta cgggattcat      1140
     gacgtcatcg actattcgca attgcggcgg atgggacgga aatatgatgc gatggaactg      1200
     gaacaggcgc agattgatcg gacagtttct gaaaacatct atgccgcctg gtcgaagcac      1260
     cggcagacga agacgatcgg cttttgttcg tcgatccgtc aagccgaata cttagcgcag      1320
     acgttccggg aaatgggaca ccaagtgatt gccttgaccg gacagaccat caatcgacgg      1380
     gagcggatcc aagagtttga acagggaacg gtagagatcg tctttacggt cgatttgttt      1440
     aatgaaggag tcgacattcc gaaagtcgat acgttactgt tttgccggcc gacggaatca      1500
     atcgcaatct acacccagca aattggacgg ggcttacgtt tagcgaatga gaaatcacat      1560
     tgtgtcatca tcgatttgat tgggaactat aaaaacgtcg aaacgaagct gatgttgctt      1620
     ggaacagtaa aagacaagct caagcggggg gataaggagc cgattacccc accaaaggga      1680
     tgcatcatcg agttcgatac acaagcgctg aatatcattc atcggatgcg tcaaccgaat      1740
     cagcggaaac tccgattgat tgagagttac gaacaattga agctcgatct cgggcgtcgt      1800
     ccaacctaca ttgagattgg tcaactgaca gccgtgccga ctggctataa acaagagtgg      1860
     agctcgtacg ttggtttcct gaaggaacaa ggtgaattga cggatgaaga aatcgagact      1920
     tacgatgcta accgtgaact gattgaacag gtcgaaaaga cggtgatgaa ccggagttac      1980
     aagatggttg tcttgctggc gatgcttgag cggggggaag gacgttggat ggagccgatt      2040
     acggctgaag aagtggcgcc atttttttat gagtatttgc atgcagagaa gtatcgggaa      2100
     gtgaaggatg cgcaaggaaa agtatttgaa aatggataca atgaatccaa aatagtgaca      2160
     ttgctgaagc aacaaccgtt tccgaagatg gtatatccgt ttgaaacgac ggaagatcag      2220
     aaaacgttat atatccaaaa ggaccttaaa accaccaata ggatattaat gaaatggata      2280
     acggatatcg ttcattttcg aattgaaagt tatttttcaa gctag                      2325
//

If you have problems or comments...

PBIL Back to PBIL home page