(data stored in ACNUC7421 zone)

EMBL: CP001022.PE311

CP001022.PE311       Location/Qualifiers
FT   CDS_pept        326468..327034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0313"
FT                   /product="Domain of unknown function DUF1788"
FT                   /note="PFAM: Domain of unknown function DUF1788; KEGG:
FT                   swo:Swol_2495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59799"
FT                   /db_xref="InterPro:IPR014858"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB6"
FT                   /protein_id="ACB59799.1"
FT                   /translation="MANLNARLDSIIPKIKEEKFIDGRGLGNEISFYVFDYEAKDELIV
FT                   RDYVKHIKKEFNYEGTDRSIIEFDLYKMLIEITKEKRIFDRVFDMEEHQGKDALFRAMT
FT                   AFAKPEVFVQKIKEQLDDHNVVFLTGIGKVYPFVRSHNILNNLQEVLDKTPVVMFFPGT
FT                   YDGQSLQLFSKFKDDNYYRAFRLVD"
     atggcgaatt taaatgcaag actagatagt atcattccaa aaatcaaaga agaaaaattt        60
     attgatgggc gcggcttagg gaatgaaatt agtttttatg tttttgatta tgaagcaaag       120
     gatgaactta ttgttagaga ttatgtaaaa cacataaaaa aagagttcaa ttatgaggga       180
     actgatagaa gtatcattga attcgatttg tacaaaatgc ttatcgagat tacaaaagaa       240
     aagcgtatct ttgatcgcgt ctttgatatg gaagaacatc aaggaaaaga tgccttattt       300
     agagctatga ccgcgtttgc caaaccggaa gtatttgtac agaaaatcaa ggaacagcta       360
     gacgatcaca atgttgtatt tctcactggc atcgggaaag tgtatccatt tgtacgttcg       420
     cacaatattt taaataacct tcaagaagta ttggataaga cacccgtggt aatgtttttc       480
     cctggaacat acgatggtca atcattgcaa ttattcagta agtttaaaga cgataattat       540
     tatagagcat ttcgcttagt tgattaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page