(data stored in ACNUC7421 zone)

EMBL: CP001022.PE317

CP001022.PE317       Location/Qualifiers
FT   CDS_pept        340507..341214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59805"
FT                   /db_xref="GOA:B1YIC2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC2"
FT                   /protein_id="ACB59805.1"
FT                   /translation="MRPIERGSIPLDRDQNEIEFNFYQQSRGHLLTRLGSYCSYCERYL
FT                   GGNIAVEHVRPKSKESNLELEWDNFLIACNNCNSIKGDRSIELDKYLWPDKDNTTLAFI
FT                   YITGGLINVSPNLNPEVIEIAENTIKLTGLDRVPSDDPFLNPEMKDRRWSERRTAFEKA
FT                   ERAKRNLFVNNTESMREQIVDTALSTGFFSTWMTVFLHDIDMLKRFIDAFPGTSKACYN
FT                   SSYTPITRVGGTL"
     atgagaccaa ttgaaagagg atctattcct ttagatagag accagaatga gatcgagttc        60
     aatttttatc aacaatccag agggcattta ctaactagat taggaagcta ctgttcctac       120
     tgtgagagat atcttggtgg aaatatcgca gtagaacatg tacgccctaa atcaaaggaa       180
     tccaacttag aattagaatg ggacaatttt ctaattgcat gtaataactg taattcaatt       240
     aaaggcgata gatccattga attggataaa tatttatggc cagataaaga taatacaact       300
     ttagcgttta tttatattac aggtggatta attaatgttt ctccgaatct gaatccagag       360
     gttattgaaa tagctgaaaa tacaattaaa ttaacaggct tagatcgtgt tccgagtgat       420
     gatccatttc taaatccaga aatgaaagat aggcgttgga gcgagagaag aacagccttt       480
     gaaaaagctg aacgcgctaa gagaaattta tttgtgaata acaccgaatc aatgagagaa       540
     caaatcgttg atacagcact ttctacgggt tttttttcaa cttggatgac tgtctttcta       600
     catgatatag acatgcttaa aaggtttatt gatgcttttc cagggacaag taaagcttgc       660
     tataattctt catacactcc aataacaaga gtgggaggaa ctttgtaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page