(data stored in ACNUC7421 zone)

EMBL: CP001022.PE324

CP001022.PE324       Location/Qualifiers
FT   CDS_pept        347965..348909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_1992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59812"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC9"
FT                   /protein_id="ACB59812.1"
FT                   /translation="MEQSEHLKEKRPGHRFPRRTVEEMELRRKMRLNHFVRQAEFFKLS
FT                   ETPDFVQAKKWLLQALRIEKNHPIANYRLGYLLYREHQYELAVYHFKTALDGTETDVLS
FT                   ETQLMLANTFLVNCGMAITREALRELEDLEFRIEGEIDQERIERYRAEMLVQEENMLDR
FT                   LYYRKITAAHETIINEEQFYDIRPDKGELLLRSSDDGKTLQVFGKPAESLNLHMFLTLV
FT                   LLNQKSFQPYPVLQDALSELGGQRISYNYMRQLIRRIRDQFVTLNLIESTSISSPDSSR
FT                   PVQGFRIHPNWSVTILCRADDFIHPIQKERSDV"
     atggaacaat ccgaacatct caaagaaaaa cggcctggac acagatttcc gagaaggaca        60
     gttgaagaga tggaactccg acgtaagatg agacttaacc attttgtccg gcaagccgag       120
     ttttttaagc tgtcggaaac accggatttt gttcaagcaa agaagtggtt gttacaggca       180
     ctacgtatag aaaagaatca tccgatcgcc aattatcgac tgggatatct tctttatcgt       240
     gagcaccagt acgaactggc ggtttatcat tttaagacgg cgcttgacgg aacggagacc       300
     gatgtcttga gtgagacaca gttgatgtta gccaatacct ttctcgttaa ttgcggaatg       360
     gcgattacac gggaggcctt gcgtgagtta gaggacttgg aatttcggat cgaaggagag       420
     atagaccagg aacgcattga acgctaccgg gctgaaatgc ttgtccagga agaaaatatg       480
     ttagaccgtt tgtattatcg gaaaatcacg gcagcccatg aaacgattat caatgaagaa       540
     cagttttacg acatccgtcc ggataaagga gagctgttac tccgaagttc ggatgatggg       600
     aaaacattgc aggtgttcgg aaaaccagct gaatcattaa acctacatat gttcttgacc       660
     ctcgtgttac tgaatcaaaa atcatttcaa ccgtatccgg ttttacagga tgccttgtct       720
     gaattagggg gacaaaggat ttcttacaac tatatgcgtc agttaatccg gagaattcgt       780
     gatcagtttg ttacgttgaa tttgattgaa tcgacatcta tttcttctcc tgattcttcg       840
     cgtcctgtcc aaggattccg gattcacccg aactggtcgg tgacgattct ttgccgggca       900
     gatgatttca ttcatccgat tcaaaaggag agaagcgatg tttag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page