(data stored in ACNUC7421 zone)

EMBL: CP001022.PE326

CP001022.PE326       Location/Qualifiers
FT   CDS_pept        350320..350619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59814"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID1"
FT                   /protein_id="ACB59814.1"
FT                   /translation="MNKAVKLIITGVLSLSLISVTSAESHAATKAKAFQNCTEMHKKYK
FT                   GGVSKKAGLKNRTGYDKKGKAIYKDTKYKAYVSLAIYKLNTKSDRDKDGIACER"
     atgaacaaag cagtgaaact catcattaca ggtgtactta gcctttcttt gatcagcgtg        60
     acatcggctg aaagccatgc agcaaccaaa gcgaaggcat tccaaaactg tacggagatg       120
     cataagaaat acaaaggcgg cgtttcgaag aaagctggac tcaaaaaccg gacggggtac       180
     gacaaaaaag gtaaggcgat ctacaaagat acgaaataca aagcctatgt cagcttagcg       240
     atatacaaac tgaatacgaa aagcgaccgt gacaaagacg gcatcgcctg cgaacgttaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page