(data stored in ACNUC7421 zone)

EMBL: CP001022.PE327

CP001022.PE327       Location/Qualifiers
FT   CDS_pept        complement(350663..350986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0330"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: bwe:BcerKBAB4_2128
FT                   thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59815"
FT                   /db_xref="GOA:B1YID2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID2"
FT                   /protein_id="ACB59815.1"
FT                   /translation="MSNYIKSEDTFKELIASETPVIIKFEADWCPDCKRMDYFMPDVES
FT                   QFSELPIYTIDKDEFPEIASDNVVMGIPSLLVFQNNEKLGHLHSANAKTPEEVTDFLKK
FT                   NFN"
     atgagtaact acattaagag tgaagataca ttcaaagagt taatcgcaag tgaaacaccg        60
     gtcatcatta agttcgaagc tgactggtgc ccggactgca aacggatgga ctacttcatg       120
     ccggacgtcg aatcacaatt cagcgaactg ccgatctata cgatcgacaa ggatgaattc       180
     ccggaaatcg cttctgacaa tgtcgtcatg gggattccaa gtttactcgt cttccaaaac       240
     aacgagaaac tcggtcactt gcacagtgct aacgcaaaaa caccggaaga agtcacggac       300
     ttcctcaaaa aaaacttcaa ctaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page