(data stored in ACNUC7421 zone)

EMBL: CP001022.PE329

CP001022.PE329       Location/Qualifiers
FT   CDS_pept        complement(352199..352540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0332"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   bwe:BcerKBAB4_3247 protein of unknown function DUF437"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59817"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016645"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID4"
FT                   /protein_id="ACB59817.1"
FT                   /translation="MLHNMGLYEEPFHSIQTGKKVIEIRLNDQKRQAIKVDDLIEFKNL
FT                   SNGEQLTVRVTKRETFKDFQSLYEKISLEAIDCIGWSMPELLKSTYAIYLKEAEQQFGA
FT                   LALTIEIIE"
     atgttacata acatggggct atatgaagaa cccttccatt ccatccaaac aggcaaaaaa        60
     gttatcgaaa ttcgcctgaa cgatcagaag cgtcaagcta tcaaggtcga tgacctgatt       120
     gaatttaaaa atttgtctaa cggtgaacag cttactgttc gggtcacaaa acgcgaaacg       180
     ttcaaagact ttcaatctct ctatgaaaaa atttcacttg aagcgatcga ttgtattggc       240
     tggtcgatgc cagagttatt gaaaagtacg tatgccattt acttgaagga agccgaacaa       300
     caatttggtg cactggcctt gacgatcgaa atcatagaat aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page