(data stored in ACNUC7421 zone)

EMBL: CP001022.PE333

CP001022.PE333       Location/Qualifiers
FT   CDS_pept        356946..357245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0336"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: sgo:SGO_0842
FT                   rhodanese family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59821"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID8"
FT                   /protein_id="ACB59821.1"
FT                   /translation="MKNMSTNELEEILQQEKTIQLIDVRETDEYAVGHIKQAKNLPLSE
FT                   LSERTDELDAGRPLHVICLSGGRSMNASTYLEQAGFDVTNVDGGMMSWEGDVTK"
     atgaaaaaca tgtcaacaaa cgaattagaa gagatattgc aacaagaaaa aacgattcaa        60
     ctgattgatg tccgcgaaac ggatgaatac gcagtcggtc atatcaagca ggccaaaaat       120
     cttccgttat ccgaactgtc agagcggacg gatgaattgg atgcaggacg gccgttacat       180
     gtcatctgct tgtccggggg acgcagcatg aatgcttcaa cctatctcga acaagccggt       240
     tttgatgtca cgaatgtcga cggcggcatg atgagctggg aaggcgacgt tacgaaataa       300
//

If you have problems or comments...

PBIL Back to PBIL home page