(data stored in ACNUC7421 zone)

EMBL: CP001022.PE334

CP001022.PE334       Location/Qualifiers
FT   CDS_pept        357276..358682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0337"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: gka:GK2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59822"
FT                   /db_xref="GOA:B1YID9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID9"
FT                   /protein_id="ACB59822.1"
FT                   /translation="MLLRYFYDEKLAQASYMVGCQMTGEAIVIDPSRDIEGYLKEAAKE
FT                   GLHIVATAETHIHADFVSGTREFAERFDTTAYLSDEGDADWKYEFAADIDAKLVTDGNR
FT                   FKVGNVTFEVMHTPGHTPEHVSFLLYDRDQTVPMGIFTGDFVFVGDIGRPDLLEEAAGI
FT                   QGTTAVGAKQMFESLKRFKALPDFVQVWPGHGAGSACGKALGAVPTTTVGYEKQTNWAL
FT                   QVEDETAFVKELTTDQPEPPNYFAMMKRVNKKGIVATPTLSKPRVAEATELETLVNTMQ
FT                   VVDTRSGKSFASGHVPGALNIPYNSKFVTWAGWLLDFDHDIAVIAEFRLLEEIQTDLQS
FT                   IGLDRFVTLVDIADLSPEQLTEQYPDWSAEQAIEAAEAGEVVVLDVRNKTEWDAGHYEQ
FT                   AKRILLGKLSSRYKEIPVDRPIAVHCASGVRSRMAVSVLQSLGMKNVINIDGGYAALQP
FT                   VLDRQALTEK"
     atgttattac gttactttta cgatgaaaaa ttagcacaag cttcttatat ggtcggttgt        60
     cagatgacgg gtgaagcgat tgtcattgat ccgtcgcgtg acatcgaagg atatcttaaa       120
     gaagcggcaa aagaaggatt acacatcgtc gcgacagcgg aaacgcatat ccatgcggat       180
     tttgtatccg gcacacggga atttgctgaa cggtttgata cgacggctta tctgtctgac       240
     gagggtgatg ccgactggaa atacgaattt gcagctgaca tcgatgccaa acttgtgacg       300
     gatggaaatc gttttaaagt agggaacgtg acatttgaag tcatgcacac gccgggacat       360
     acgccggaac atgtctcatt tttactgtat gaccgcgatc aaacggttcc gatgggcatt       420
     tttacaggag actttgtttt tgtaggcgac atcggtcgcc cggatttact cgaagaagca       480
     gccggtattc aagggacgac agctgtcggc gcaaaacaga tgtttgaatc acttaaacga       540
     ttcaaagcgt taccggactt cgttcaagta tggccgggtc atggagccgg cagtgcgtgc       600
     gggaaagccc tcggtgcggt tccgacgacg acagtcgggt atgaaaaaca gaccaactgg       660
     gctcttcaag tcgaagacga aacggcgttc gtcaaagagt tgacgacaga ccaaccggaa       720
     ccgccgaact attttgcgat gatgaagcgg gtcaacaaaa aaggaattgt cgccacacct       780
     acgctttcga aaccacgtgt cgccgaggcg actgaactgg aaacgcttgt caatacgatg       840
     caggtcgttg acacacgtag cggaaaatcg tttgcttcgg gacatgtgcc gggggcgctc       900
     aacattccgt acaattcaaa attcgtcacg tgggccggct ggctactgga ctttgatcat       960
     gatattgccg tgattgccga gttccgttta ctggaagaaa tccagaccga tttacagtcg      1020
     atcggtctcg accggttcgt cacattggtg gatatagcgg atttgtcacc cgaacaattg      1080
     acggaacagt atccggactg gagtgccgaa caagcaattg aagcagcgga agccggtgaa      1140
     gtggttgtcc tcgatgtccg caataagaca gaatgggatg cgggccatta tgagcaggcg      1200
     aaacggattt tacttggtaa actgtcctcg cgttacaaag aaattccggt cgatcgtccg      1260
     atcgcagtcc actgtgcctc cggtgtccgg tcacgaatgg cagtcagtgt cttacaatca      1320
     ctgggcatga agaatgtcat caatattgac ggcgggtatg ctgctcttca gccggttctt      1380
     gaccgacagg cgttaacaga aaaatga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page