(data stored in ACNUC7421 zone)

EMBL: CP001022.PE335

CP001022.PE335       Location/Qualifiers
FT   CDS_pept        358866..360671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0338"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: bsu:BSU09390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59823"
FT                   /db_xref="GOA:B1YIE0"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE0"
FT                   /protein_id="ACB59823.1"
FT                   /translation="MKNFWNTTSFDVNGILGTLGNILGALIVFLIGWLIAKLIANGIQK
FT                   ALEKSGVVNKLSPQKEGTPPQKKKWTPEKIIGTVIFWVLMVFVLILVFNILNLNIIAGP
FT                   LADTMSTLLAAIPNILKAALILLFAYVIAVVLRMIIVKGGTKLMSNEKVRSNKMLQGQT
FT                   DLSNYPKIAGEIVFYLVLLLFLPGVLGALNIESVSEPFSQLLSSFLGFIPRLIAAAAIF
FT                   FVGFLVAKIVRDIVTNFLHAVGTDKFASRFNIGTNEQKDTKSLSSILGTVVFILILIPI
FT                   TISALDQLNIKGITGPAINMLNDVLGMIPNIIIGVVLILVGLYVGRFVKKFVADLLSRL
FT                   GFNNLTRHLKIGNWDANNASTSPSSIVGSLVEIVIVVLFVVEAFNLIGLDFMVDLGRAV
FT                   LAFLPSVLTAIIILAIGIIISNLVKRTMDSLFANSDLKVLSSVAKYAILALAVFMALDQ
FT                   LGVAATIVNSAFILILGAVALAFGLAFGLGGRDNASRYLDRLQKKAENADIDTSNLPSN
FT                   NTSSASTKPSLKEAAKGAASKAADDVTPDQAPKASKPSSSLNVNPTHGTPKGALPKNDL
FT                   AQQDDYPIGPDTNRGPNLDHPNDRP"
     atgaaaaact tttggaacac gacgtcattt gacgtcaacg ggattctagg gactctcgga        60
     aacattttag gagcacttat cgtcttcctg attggatggc tgattgcgaa actgatcgca       120
     aacggtattc aaaaggcatt agaaaagtct ggtgtcgtta ataagttgtc accacaaaaa       180
     gaaggtacac caccacaaaa gaaaaagtgg acacctgaaa aaattatcgg gacagtcatt       240
     ttctgggtct tgatggtatt tgttcttatc ctagtcttta acatcttgaa cttgaacatc       300
     atcgcaggac cacttgcgga tacgatgagc acattgctcg cagcgatccc gaatatcctg       360
     aaagcagcat tgattcttct ttttgcttac gtcatcgcgg ttgtactccg catgatcatc       420
     gtcaaaggcg gaacgaagtt gatgtcgaac gaaaaagtcc gttcgaacaa aatgcttcaa       480
     ggtcaaacgg atctttcgaa ctatccgaag atcgcaggcg aaatcgtctt ctatcttgtc       540
     ttgttactgt tcctaccagg tgtacttggt gcgctcaaca ttgaaagtgt ttctgagccg       600
     ttcagccaat tactctcgtc gttccttgga ttcattccgc gtctgattgc tgcagcagcg       660
     atcttcttcg tcggattcct cgttgcgaaa atcgttcgcg atatcgtcac gaacttcctg       720
     catgcagtcg gtacagacaa atttgcttca cgcttcaaca tcggtacaaa cgaacaaaaa       780
     gatacaaaat cactttcttc aatcttaggg acagtcgtct tcatcctgat cttaatcccg       840
     atcacgattt cggcacttga ccagctcaac atcaaaggta ttacaggacc agccatcaac       900
     atgttaaacg atgttcttgg tatgattccg aacatcatta tcggtgtcgt cttgatcctt       960
     gtcggtcttt atgtcggtcg tttcgttaag aaattcgttg cagatctctt gtcacgtctc      1020
     ggtttcaaca acttaacacg tcacttgaaa atcggtaact gggatgcaaa caatgcatcg      1080
     acatcaccat catcaatcgt tggatcactc gttgaaatcg tcatcgtcgt cttgttcgtc      1140
     gttgaagcct tcaacttaat cggtcttgac ttcatggttg atcttggtcg cgcggttctt      1200
     gctttccttc caagcgtctt gacagcgatc atcatcttgg ccatcggtat catcatcagc      1260
     aacttggtga aacgcacgat ggacagcctg tttgctaact cggatttaaa agttctttca      1320
     agcgtcgcga aatatgccat ccttgctctt gctgtcttca tggcacttga tcaacttggt      1380
     gttgctgcta caatcgttaa ctcagcgttc atcttgattc tcggtgctgt tgctcttgct      1440
     ttcggactcg cgtttggttt aggtggccgt gataatgcat cacgttacct cgaccgtctc      1500
     cagaaaaaag cagagaatgc agatatcgac acatcgaacc tgccgtcaaa caacacatcg      1560
     tctgcttcga cgaagccaag cttaaaagaa gcagcaaaag gtgcagcgtc aaaagcagca      1620
     gatgacgtca caccagatca agcaccaaaa gcgtctaaac catcatcttc tttgaacgtg      1680
     aacccgacac acggtacacc aaaaggggca cttcctaaaa atgatttagc acaacaagac      1740
     gattacccga tcggtccgga cacgaaccgt ggtccgaact tagatcaccc gaatgatcgt      1800
     ccgtaa                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page