(data stored in ACNUC7421 zone)

EMBL: CP001022.PE338

CP001022.PE338       Location/Qualifiers
FT   CDS_pept        complement(363364..364050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59826"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE3"
FT                   /protein_id="ACB59826.1"
FT                   /translation="MKKLLVSACLFSVLSIQPLHSEAASYSKKIKQDFTIYDQAKKKYT
FT                   VSMRSSKASCHKATSNDIWWIKGKDELCSGKFVLYLNGKSTNYKYTYTKSNPYVFSTTD
FT                   AKTSAVLKNKTGYPTVFSLTNKETYSFLNLKTYTVLNKKLTKQSNTLTSYAIKPKMNGN
FT                   LVQAPIYDNGGYGFGYVFNDLTVSGTKWIDERSHDYISQDPNSKRYKNGVSEMKKYQNS
FT                   LSYFVK"
     atgaaaaaat tacttgtatc cgcttgctta ttttcggttt tgagtattca acctctacat        60
     tctgaagctg cctcttactc taaaaaaatc aaacaagact ttactatcta tgatcaggct       120
     aagaaaaagt atactgtttc aatgcgttca tctaaagcaa gttgccacaa agctacttca       180
     aatgatattt ggtggattaa aggtaaggac gagttatgta gcggaaaatt tgttctttat       240
     ttgaacggga aatctaccaa ttacaaatat acgtatacca aatcaaatcc ttatgtattc       300
     agtacgacag atgccaaaac aagtgccgtt ctcaaaaaca aaacaggata ccctactgtt       360
     ttttcgctga caaacaaaga aacttattcg tttcttaacc taaaaacata cacagtttta       420
     aataaaaaac tcacaaaaca aagtaacact ctaacgtcgt atgcaatcaa accaaagatg       480
     aacggcaatt tagtacaggc tcctatttat gataatggtg gttatggatt cggttacgtc       540
     tttaatgacc ttacagtaag cggtacaaaa tggattgatg aacgttcaca cgattacatc       600
     tcacaagatc caaacagtaa aagatataaa aatggtgtaa gcgaaatgaa aaaatatcaa       660
     aattcattga gttattttgt aaaataa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page