(data stored in ACNUC7421 zone)

EMBL: CP001022.PE341

CP001022.PE341       Location/Qualifiers
FT   CDS_pept        365924..366781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0345"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: bsu:BSU07900
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59829"
FT                   /db_xref="GOA:B1YIE6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE6"
FT                   /protein_id="ACB59829.1"
FT                   /translation="MSLLKPVFARFFGEAFFDKSAQLAYYLMLSLFPFLLFVVGLVSFL
FT                   PFTSGDVLDLIRPFAPAETYDLIRKNVVGIFDNGGLKLASISFLAAFWLASMSVQSLVR
FT                   SLNDALEVTRKVPFWRGLLQDFGFTVGMMIILPMSLLVPVAEKLTRRFITHFAIVNDVV
FT                   TNYSWIWFLFRWGLGSLFLLVFFILLYRVLPSVRLTVRQVLPGALFATIAWQAVSEFFS
FT                   YYAEFGSYDRLYGQLAGIIVLMTWFYLSSVVLMLGGLMNAERMRQKKEAKVLKPEKIKQ
FT                   ETVR"
     atgtcattat taaaacctgt atttgcccga ttttttggcg aagccttttt tgataaatcg        60
     gctcagcttg cttattatct gatgttgtcc ttattcccat ttttattatt cgtagtgggc       120
     cttgtgtctt ttttaccgtt cacatcgggt gacgtcctcg atttgatccg tccgtttgct       180
     ccggcggaaa cctatgattt aatccggaaa aatgtcgtcg ggatttttga taacgggggc       240
     ctgaaactgg cctcgatcag cttcctggca gccttttggc tcgcttcgat gtcggtccag       300
     tcactggtcc gttcgttaaa tgatgcgcta gaagtcacgc ggaaagtgcc gttttggaga       360
     gggttactgc aggactttgg ttttacggtc ggaatgatga ttatcttacc gatgtcgctt       420
     ctcgttccgg ttgctgaaaa gttaacgcgg cgtttcatca cgcattttgc gatcgtcaat       480
     gatgtcgtca cgaactactc ctggatttgg tttttattcc gttggggact cggatcactg       540
     ttcctgttgg tcttcttcat tctgctgtat cgtgttctac cgagtgtccg gttaacagtc       600
     cgtcaagtct taccgggtgc attgtttgcg acaatcgcct ggcaggctgt ttctgaattc       660
     ttctcgtatt acgcggaatt cggcagttac gaccgtctgt atggacaact ggccggaatt       720
     atcgtcctga tgacgtggtt ctatttgtca tctgtcgtcc tgatgctcgg tggattgatg       780
     aacgccgaac ggatgcgtca aaagaaagaa gcgaaagtct taaaacctga aaaaatcaaa       840
     caagagactg tccgttaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page