(data stored in ACNUC7421 zone)

EMBL: CP001022.PE342

CP001022.PE342       Location/Qualifiers
FT   CDS_pept        complement(366778..367644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0346"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bha:BH1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59830"
FT                   /db_xref="GOA:B1YIE7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE7"
FT                   /protein_id="ACB59830.1"
FT                   /translation="MDLLLFLVLGAAIGILSGFFGIGGGIILTPLLLILGYTPSTAIVL
FT                   SLLLTLGSTVTGTFAHLRQNNFHLRDAVTIGVSGIIGSAAITPVVFWMERHSGADTVIS
FT                   TLYIVLLLLFAIQFLKPAKKVVQETPVPHASFYKLVAIGAAAGILSSLMGVSGGFLLTP
FT                   LLMGWVRFPLKQAIGTSIAAATLIVLGGVTSYFMSGTQAPLALGIALIIGALIGSPLGA
FT                   SFLNLFSSQFVKKSLGSFYAAVAASVFLKTTHYEQLSLLLLALFTTGLIGVFFYQKVIQ
FT                   RQTKDCP"
     ttggatttat tactttttct tgtactcgga gccgcaatcg gcattctatc cggttttttc        60
     ggaatcggcg ggggcatcat cctgacccct cttttattga tattaggata cactccgagc       120
     accgcaatcg tcttaagttt acttttgaca ctcggttcga cggtgacagg cacctttgcc       180
     catctccgtc aaaataactt tcaccttcgg gatgctgtca cgattggcgt ttccggtatc       240
     atcggctccg ctgcgattac gcctgtcgtc ttttggatgg aacggcacag cggtgccgat       300
     acggtcatct ccacccttta catcgtcctg ctcctgttgt ttgccatcca gtttttgaaa       360
     ccggctaaaa aagtggttca ggagacacct gtgccgcacg cctcgttcta taaactggtc       420
     gcaatcggtg ccgctgccgg aatcctgtcg tccttgatgg gcgtcagcgg tggattttta       480
     ttgacaccgc ttttgatggg atgggtgcgt ttcccgctga agcaagcaat cggaacaagt       540
     attgcggcag ctacgttgat tgtactcggc ggcgttacga gttatttcat gtcaggtaca       600
     caggctccgc ttgctttagg gattgcttta atcatcggag cactcatcgg ctcgccgctt       660
     ggcgcatcat tcctcaatct cttcagcagt caattcgtca aaaagagtct gggcagtttt       720
     tatgccgccg ttgcagccag cgtgttctta aaaactacgc actatgaaca actctcgtta       780
     cttctgctcg ccttgtttac gaccggtttg atcggtgtat tcttctatca aaaagtaatt       840
     caacgtcaaa caaaagactg cccttaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page