(data stored in ACNUC7421 zone)

EMBL: CP001022.PE345

CP001022.PE345       Location/Qualifiers
FT   CDS_pept        369024..369503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_0691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59833"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF0"
FT                   /protein_id="ACB59833.1"
FT                   /translation="MSEIKKTMIVLFSGDYDKVMAAYIIANGAAAYDHEVTIFHTFWGL
FT                   NAMRKDEPIQPDKTLLEKMFGKFMPRGADKMPLSKMNFGGAGQKMIKNVMKKHNAMPLP
FT                   DLIELAKEQDVKLVACTMTMDLLGLKQEELHDGIEYAGVAAYLADAEDGNVNLFI"
     atgtcagaga ttaaaaaaac aatgattgtc ttgttcagtg gagattacga taaggtcatg        60
     gcagcgtata tcatcgccaa cggcgcagcc gcttacgacc atgaggtgac gattttccat       120
     acattctggg gattaaacgc aatgcgtaaa gatgaaccga ttcaaccgga taaaacatta       180
     cttgaaaaaa tgttcggcaa attcatgccg cgcggtgccg acaaaatgcc gctctccaaa       240
     atgaacttcg gtggcgccgg ccagaagatg atcaaaaacg tcatgaaaaa acacaacgca       300
     atgccgcttc ccgatttaat tgaactggca aaagaacaag acgtgaagtt ggttgcatgt       360
     acgatgacaa tggatctgct cggtttaaag caagaagaat tgcatgatgg gatcgaatat       420
     gccggcgtag cagcgtatct tgctgatgct gaagacggaa acgtcaacct gttcatctaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page