(data stored in ACNUC7421 zone)

EMBL: CP001022.PE347

CP001022.PE347       Location/Qualifiers
FT   CDS_pept        369907..370203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0351"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: gtn:GTNG_1980
FT                   molybdopterin biosynthesis MoeB protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59835"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF2"
FT                   /protein_id="ACB59835.1"
FT                   /translation="MKRFTAKEVQEKLENGEQLNIIDVREVDEVKEGKIPNAIHIPLGL
FT                   VEFKMNELDKKKQYVMVCRSGARSGRAATYLEGQGYDVINMDGGMMAYEGKTN"
     atgaaacgat tcacagcaaa agaagtacag gaaaagctag agaacggaga acaacttaac        60
     attattgatg tccgtgaagt ggatgaagtc aaagaaggta aaattccaaa tgcgattcat       120
     attccactcg gtctcgtcga attcaaaatg aacgaactcg ataagaaaaa acaatacgtc       180
     atggtttgcc gttccggtgc ccgcagcggc cgtgccgcaa cgtatcttga aggacaaggc       240
     tatgatgtca tcaatatgga tggcgggatg atggcgtacg aaggtaaaac caactaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page