(data stored in ACNUC7421 zone)

EMBL: CP001022.PE348

CP001022.PE348       Location/Qualifiers
FT   CDS_pept        370252..370818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0352"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; Rhodanese domain protein;
FT                   KEGG: gka:GK2066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59836"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF3"
FT                   /protein_id="ACB59836.1"
FT                   /translation="MQTIKTDIVLDARGLACPMPIVRTKKTMKTLEPGQVVEVQATDKG
FT                   STADLRAWANSTGNQYLGTIEDGDVLRHYVRKASGNDQEAPAFQKVVNNETVEAVCGNA
FT                   DIMILDVRETAEYAFSHIPSAVNIPLGELEERIEELDSSKTIYVVCRTGNRSDLACQQL
FT                   DAKGFNVQNVVPGMSDWKYDTNQTV"
     ttgcagacaa tcaaaacaga tatcgtactt gatgcacgtg gtttagcatg tccgatgccg        60
     attgttcgga cgaaaaaaac gatgaagaca ctggaaccgg gtcaagtcgt agaagttcaa       120
     gcgacagata aaggatcgac ggctgatctt cgggcctggg ccaacagtac aggcaaccaa       180
     taccttggaa cgattgaaga cggcgatgtt ctacgtcatt acgtccggaa agcttccggt       240
     aatgatcagg aagcgccggc atttcaaaaa gtcgtcaaca acgagacggt cgaagccgtt       300
     tgcggcaacg cggatataat gattctggat gttcgggaaa cggcggaata cgccttttca       360
     cacatcccga gtgccgtcaa cattccactc ggtgaactgg aagaacgtat cgaagaactc       420
     gactcgtcga aaacaattta tgtggtctgc cggacaggaa accgcagtga cttagcttgc       480
     caacaactcg acgctaaagg atttaacgtt caaaacgtcg ttccgggtat gagtgactgg       540
     aaatacgaca caaatcaaac cgtttaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page