(data stored in ACNUC7421 zone)

EMBL: CP001022.PE355

CP001022.PE355       Location/Qualifiers
FT   CDS_pept        378036..380573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0359"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: drm:Dred_1556
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59843"
FT                   /db_xref="GOA:B1YIG0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG0"
FT                   /protein_id="ACB59843.1"
FT                   /translation="MINWIRRRIGRQLLAVFYVLLFLVSMTSFLVYGYMENRIESSRDN
FT                   LEVISEQNRRADHLWDNWQNVQFGLRGFVIFGNQERFDEIQELRTEIKSETDWFTRKAK
FT                   TDEEEEFAAQMTNMYNLYYGALFPLTQSYVNEKKANQINEDFLQGDSLFSLPIAKRLVE
FT                   QGQLKQTADGSIDVEPDIEKASSALNEYRNNLQQQQDTAVANLRSEVAKTKWIWISSIF
FT                   VLIIFILLFVHPFLKRMTKQLLRLIEDNRKLSRNEPIEMDVMERRADEIGMLRSSFNQM
FT                   AVTTGLHKEEMQNKNEELQAQSEELLAQQEELQSQQEELEEAYQATKQNEEKLKMRSEL
FT                   TEALAVRETVESYPAIVQKMLDITSSEYGALLLYDDGVYIGATTNGMKIQQVQSLLDDE
FT                   NSLLNRMRLGTKVVQSEKRVSRTNDTPYSFSTYEVALPIYDPSTHQLMAAVYMVRYQSP
FT                   YQSQQLADMREFSQQMTLSLLRTRSYDEMKQEKQKTEQVLDSIREAIIYLEDGNDELYV
FT                   NRPLFELIPELQSEFTRDRTLSSASYVIEVMRNIVDDVERFNDYLDLIRSGEVSPDKVQ
FT                   FDVRGNSAHLEVYAERIDIEGGWKGVILVIRDITRETEADRLKTELVSTVSHELRTPLS
FT                   SIYGFTELMLNREIDAIKQQKYLSTIHNETERLSNLVTDFLDVQRMQSGGQRYQMAHLD
FT                   LYSIVDQVIGVYKASNGLHDIQLHLLSVERPAIIGDETRIKQLLNNLVNNAIKYSPDGG
FT                   QVDITVSTDQENATIQITDHGIGIPQYAFAHLFDKFYRVDNSDTRRIGGTGLGLSICKE
FT                   IVKEHDGVIHVESTVGKGSTFTVALPLHALENV"
     atgattaatt ggattcggag acgaatcggg cggcaattat tggcagtatt ttatgtctta        60
     ctgtttttgg tttcgatgac ttcctttttg gtttatggtt acatggaaaa tcgaatcgaa       120
     tcatcacgcg ataacttgga agtcatcagc gaacaaaatc gtcgtgcgga tcatttatgg       180
     gataactggc agaatgtcca gtttggtttg cggggatttg ttattttcgg taaccaggaa       240
     cgttttgatg aaatccagga gctgcggaca gaaatcaaaa gtgaaacgga ttggtttacc       300
     cgtaaagcca aaacggatga agaagaagaa tttgccgctc aaatgacgaa tatgtacaac       360
     ttatattatg gggccttgtt tcctttgacc cagtcatacg taaatgaaaa aaaggcgaat       420
     caaatcaatg aagatttttt acagggtgac agtctgttct ctttaccgat tgccaaacga       480
     ttggtggaac aaggtcaatt aaaacaaaca gcggacggtt cgattgatgt cgaaccggat       540
     attgaaaaag cctcttcggc attaaatgaa taccggaata atttacaaca acagcaggat       600
     acggccgttg ccaacctccg gagtgaagtc gcaaaaacga aatggatctg gatttcgagt       660
     atctttgtcc tgattatctt tattttactg tttgttcatc cgttcctgaa acgaatgacg       720
     aaacagttat tacgcctgat tgaggacaat cgaaagctgt cgcggaacga gccgattgag       780
     atggatgtta tggagcggcg ggcagatgag attggcatgt tgcgttcttc ctttaatcag       840
     atggctgtga caaccggtct gcataaagaa gagatgcaaa ataaaaacga agaattacag       900
     gcgcagagtg aagaattact ggcccaacaa gaagaattgc aatcgcaaca agaagaactc       960
     gaagaggcgt atcaggcgac gaaacaaaac gaagagaagc tgaagatgcg cagcgaatta      1020
     acggaagcac tcgctgtccg ggaaacagtc gaatcgtacc cggcgattgt tcaaaaaatg      1080
     ttggatatca cttcatccga atatggagcc ttgttgttgt atgacgatgg cgtttacatc      1140
     ggtgcgacga cgaacggcat gaagatacaa caggttcaat ccttactgga tgatgagaat      1200
     tccttattga accggatgcg gttagggaca aaagtcgttc agtcggaaaa acgggtttcg      1260
     cggacaaacg acacaccata cagcttcagt acgtatgaag ttgctttgcc gatttatgat      1320
     ccatcgacgc atcagttgat ggctgccgtc tacatggttc gttatcagtc tccataccag      1380
     tcgcaacagt tggcggatat gcgtgagttc tcgcaacaga tgactttatc cctgttgcgg      1440
     acgcgttcat atgacgagat gaagcaggaa aaacaaaaga ccgagcaggt acttgactca      1500
     atccgggaag caattattta tctggaagac ggaaatgatg aattatacgt caaccgtccg      1560
     ttgttcgaac tgataccgga gctgcaatcc gaatttacga gggaccggac tttatcgtcg      1620
     gccagttatg tgattgaagt gatgcgtaat atcgtcgatg atgtcgaacg atttaacgat      1680
     tatttggact tgatccggtc cggggaagtt tctccggata aagttcaatt tgatgtccgt      1740
     ggtaattccg cacatcttga agtatatgca gaacgaatcg atattgaagg tggttggaaa      1800
     ggggtcatcc tcgtcatccg tgatattacc cgggaaacag aagcagaccg tctgaagacc      1860
     gaacttgttt cgacggtgtc tcacgaattg cggactccct tgtcttcgat ttacggattc      1920
     acggaattga tgctcaatcg ggagattgat gcgataaaac aacagaaata tttgtcgacg      1980
     attcataatg aaacggaacg gctgtcgaat ttggtgaccg atttcctcga tgttcaacgg      2040
     atgcaatcgg gtggacaacg ttaccaaatg gctcatcttg atttgtattc gattgtcgat      2100
     caagtgattg gtgtctataa ggcgtcaaac ggacttcacg atattcagct tcacttgttg      2160
     agtgtagaac gaccggcgat tattggagac gaaacacgga ttaagcagtt gctgaacaat      2220
     ttagtcaaca acgccatcaa gtattcaccg gacggtggac aggttgacat tacagtcagc      2280
     acggatcagg aaaatgcgac gattcagatt accgatcacg gtatcgggat tccacaatat      2340
     gcctttgccc atctgtttga taaattttat cgtgtggata attcagatac acgacgaatc      2400
     gggggtacgg gacttggtct ttcgatttgt aaggaaatcg tcaaagaaca tgacggtgtg      2460
     attcatgtcg aatcgactgt cggaaaggga agtaccttta cggtcgccct gccgttgcac      2520
     gcattggaaa atgtctaa                                                    2538
//

If you have problems or comments...

PBIL Back to PBIL home page