(data stored in ACNUC7421 zone)

EMBL: CP001022.PE356

CP001022.PE356       Location/Qualifiers
FT   CDS_pept        380765..382285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0360"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: pin:Ping_1306 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59844"
FT                   /db_xref="GOA:B1YIG1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG1"
FT                   /protein_id="ACB59844.1"
FT                   /translation="MHKLIYTIIGGWVMSHLLWLGIIGTSSDLSRTGNSLFMILGAVLS
FT                   TIMLVAAARRHPNRPITQRLFLLLLFGNMSLAMGETAELIVSQQHLERSGMFDGIDLIF
FT                   SLQIGFYLLAFCYFLISRRSEVNLRFFLFDELIILIVTGAISWHYLVTPYLEQAELFSM
FT                   ETLLLLRYPLGDLLLLGGMLILFFGVMKRGNSIPLLMILIGFHLQLIADLLYVILDRTS
FT                   FPISLMWLDPIWIATVLLIGGAGLLFDVDERPIGFNVNRRILDGIRLVTPYVFLLILFV
FT                   TMARQAVSWNGLTIGLMIAIPLLISRQVRIVMDNQRLRENLEAKVEERTAALEQALEEM
FT                   EHMAYHDALTNLPNRYLFARLFKEELRRAEIHQRFVGLFFIDIDHFKQVNDTYGHQIGD
FT                   QLIIDIANRLEKKLPHNTVISRQGGDEFVLLLFDVKDESDIEACGRQLVQLFERPFILK
FT                   DTPVFMTASIGGAVYPTHATSRTALIEQADVAMYEAKRRGKNQFHVEV"
     atgcataaac taatctatac catcatcggc ggatgggtga tgtctcattt gttatggtta        60
     ggaatcatcg gcacatcatc ggatctttcg agaacaggga acagcctgtt catgattcta       120
     ggcgcggtcc tttcgacgat catgttggta gcggcggcgc ggcgtcatcc gaatcgtccc       180
     attacgcaac gtctattttt actgctctta ttcggaaata tgtcgctggc gatgggcgaa       240
     acggcagaat tgatcgtgtc ccaacagcac ttggaacgtt ccggaatgtt tgatggaatt       300
     gatttaatat tcagtctgca aatcggattt tatttgctgg ctttttgtta ttttttaatc       360
     agtcgccgtt cagaagtgaa tttacgattt ttcctatttg atgaactcat cattttgatt       420
     gtgacagggg cgatttcctg gcattatctc gtcacgccgt atttggaaca ggcggaactg       480
     ttcagcatgg aaacactgtt attactccgt tatccattag gagatctgtt gttactgggt       540
     gggatgctga tcctgttctt tggtgtcatg aaacgtggaa acagtatccc gcttctgatg       600
     atattgattg gttttcatct gcagttgatt gcggatttat tatacgtcat tttggatcga       660
     accagttttc cgatttcttt gatgtggttg gatccgattt ggattgcgac cgtcttatta       720
     attggcgggg caggactgtt atttgatgtc gatgaacgac cgattggatt taacgtcaac       780
     cggcggattc tggacgggat tcgtctcgtg acaccgtatg tcttcctgtt gattttgttt       840
     gtgacaatgg cacgtcaagc cgtcagttgg aatggtttaa cgattggttt aatgattgcc       900
     attcctttat tgatttcaag gcaggttcgg atcgtgatgg acaatcaacg gttgcgggaa       960
     aatcttgagg cgaaagtcga ggagcggacg gcagcactcg aacaggcatt ggaagagatg      1020
     gagcatatgg cttatcatga cgcactgacg aatttaccga accggtattt gtttgcccgc      1080
     ttgttcaagg aggaacttcg ccgggcggaa attcatcaac gatttgtcgg tctgtttttc      1140
     atcgatattg atcattttaa acaagtgaac gatacatacg gccatcaaat tggagatcag      1200
     ttgatcattg atatcgccaa ccgtcttgaa aaaaaattgc cgcataatac ggtcatctcc      1260
     cgacaaggtg gggatgagtt tgttttacta ttatttgatg tcaaagacga atcggacatc      1320
     gaagcatgtg gccgacagct ggttcagtta ttcgaacgac cgttcattct gaaggacacg      1380
     cctgtcttca tgacggcaag cattggcggc gctgtctatc cgacgcatgc gacttcccgg      1440
     acggcattaa tcgaacaggc ggatgtcgcg atgtatgaag cgaagcggcg cgggaaaaat      1500
     caatttcatg tggaagtctg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page