(data stored in ACNUC7421 zone)

EMBL: CP001022.PE357

CP001022.PE357       Location/Qualifiers
FT   CDS_pept        complement(382330..382962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0361"
FT                   /product="Fibronectin-binding family protein"
FT                   /note="PFAM: Fibronectin-binding family protein; KEGG:
FT                   bld:BLi02533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59845"
FT                   /db_xref="InterPro:IPR010841"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="InterPro:IPR038344"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG2"
FT                   /protein_id="ACB59845.1"
FT                   /translation="MEPFIQPFQYNFIRSQIDSMIQQLSAVHDPDVRDAVIYSASKKIF
FT                   DLLPVLTAEQEALLMVVRTVQTEADFARYLEDIQPFVQSFPSITEQQLQQLFRKTKKLR
FT                   HPPLHSIDFLKTTYLSWNDTGNKKKFFVYPLKGEWIGIEGTYLPTIQKGICTICNQYSD
FT                   VTLVSARTNQSADQYRAIGNYICIDSDHCNEQVTDPIALEKLLSKMK"
     atggaacctt tcattcagcc atttcagtat aattttatcc gcagccagat cgactcgatg        60
     attcaacagt taagcgctgt ccatgatccg gacgtccggg acgccgtcat ttacagcgct       120
     tctaaaaaaa tctttgattt gcttccggtt ttgactgccg aacaggaggc gttattgatg       180
     gtcgttcgaa ccgttcaaac cgaggcggat ttcgcccggt accttgagga tatccaacca       240
     ttcgtccaat ccttcccgtc gattaccgaa cagcaactgc agcaactgtt tcgaaaaacg       300
     aagaagttac ggcacccgcc ccttcactca atcgattttc ttaagacgac ctatttaagt       360
     tggaacgaca ccgggaataa aaagaaattt tttgtctatc ctttaaaagg agaatggatt       420
     ggaatcgaag gcacgtatct tccgacgatt caaaaaggca tctgtaccat ctgcaatcaa       480
     tacagtgatg tcacccttgt ctccgcccgg acgaatcaat cagctgatca ataccgggca       540
     atcggaaatt atatttgtat cgacagtgac cattgcaatg agcaggtgac tgacccgatc       600
     gctttggaga aactactgag taagatgaaa tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page