(data stored in ACNUC7421 zone)

EMBL: CP001022.PE359

CP001022.PE359       Location/Qualifiers
FT   CDS_pept        383884..384333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU07550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59847"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG4"
FT                   /protein_id="ACB59847.1"
FT                   /translation="MGKKQLIGTYENETDLIRQIEDLHFAGYLEEDLYVVLQDKTDMAM
FT                   LRGQSAAQLVSGKRTLFERFTGKPVTEEETREAFESLGLPEGDMEQHVASVKHGAYVLL
FT                   ADEEGARRPKPEPQSILESEPEGIEAERKLDHENRALENENDRML"
     atggggaaaa aacagttgat cggaacatat gagaatgaga cggatttgat tcgccagatt        60
     gaagatttac actttgccgg atacctggaa gaagatttat atgtcgttct gcaggataaa       120
     accgatatgg cgatgttgcg tggccaatcg gcagcccagc ttgtttcggg aaaacggaca       180
     ttatttgaac ggtttacagg gaagccggtg acagaggaag agacccgtga agcgttcgaa       240
     tctttaggtt tgccggaagg tgacatggaa caacatgtag caagcgtcaa acacggggct       300
     tatgttctgt tggcggatga agaaggggca agacgcccta aaccagaacc ccaaagtatt       360
     ttagagagtg aaccggaagg cattgaggct gagcggaagc ttgaccatga aaaccgggca       420
     cttgagaacg aaaacgaccg gatgttgtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page