(data stored in ACNUC7421 zone)

EMBL: CP001022.PE364

CP001022.PE364       Location/Qualifiers
FT   CDS_pept        388440..389291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0368"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcz:BCZK2155 Zn-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59852"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG9"
FT                   /protein_id="ACB59852.1"
FT                   /translation="MQQFKQLTDRIWYQTPVSETDRPIVAVITGDDRSLVIDAGNSSQH
FT                   ATLFLEEMKNQGLGRPDLVALTHWHWDHIFGIKQMAVPTIATHRTVEEIQKMLDYEWTD
FT                   EALEERIRQGIEIPFCADAIKLEFGKDREIEVILPTIRFTGELAIDLGGVTCLLRQVEN
FT                   DHSPGSALVYIPEERVLFLGDAMYADIFSDKWNYTVNQTTRLLDTIAEYEADYYVWSHG
FT                   EAMAKDAFEQEVHVLRQIIEVTKQAEGHVSEMRRLYRDLVGRDLTTDEEETLVFFANGA
FT                   KK"
     atgcaacagt ttaaacaatt aacggaccgg atctggtatc aaacgccggt cagtgaaacg        60
     gatcggccga tcgttgccgt cattacgggc gacgaccgga gtcttgtaat tgatgccgga       120
     aactcaagtc agcacgcgac actcttttta gaggagatga agaatcaggg gctcggacgt       180
     ccggatctcg tcgcattgac gcattggcac tgggatcata ttttcggtat aaaacagatg       240
     gcggtaccga cgattgcgac gcaccggaca gtcgaagaaa ttcagaaaat gctggactac       300
     gaatggacgg atgaggcgct cgaggaacgg attcgtcaag gcattgaaat tccgttttgt       360
     gcggatgcga tcaaactgga gttcgggaag gaccgggaga ttgaagtcat cttgccgacg       420
     attcgtttca cgggagaact tgcaatcgac ctcgggggcg tgacgtgtct gttacgacaa       480
     gtcgagaatg accactcacc agggagtgct cttgtctata ttccggaaga acgggtttta       540
     tttttaggag atgccatgta tgcggatatt ttctccgaca agtggaatta tacagtcaat       600
     caaacaacgc ggctgttaga tacgattgct gaatacgagg cggattatta tgtctggtct       660
     cacggcgaag cgatggcgaa agacgcgttt gagcaagagg tacacgtctt acgccaaatc       720
     atcgaagtga caaaacaagc agaaggacat gtatcggaga tgcgccggct gtatcgtgat       780
     ctggtcggac gggacttgac gacagacgaa gaagaaacac tcgtattttt tgcgaatggt       840
     gcgaaaaaat aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page