(data stored in ACNUC7421 zone)

EMBL: CP001022.PE366

CP001022.PE366       Location/Qualifiers
FT   CDS_pept        390466..391626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0370"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bha:BH1094
FT                   transcriptional repressor of the xylose operon"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59854"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH1"
FT                   /protein_id="ACB59854.1"
FT                   /translation="MVKEMPRNSKWMRSYNRALVLRLIRMHQPISRVELAQQTKLTKPT
FT                   VSNIVGELIADQLVMERELGVSNGGRKPILLELVAKEQYVIGIDATSHRFIGVIADLSG
FT                   NTIHEVETMGKFDTNEELMEAVVQLCQQLIDATDQVGTIHGIGISVHGMVNPETGVILF
FT                   APRFHLHDVALKEHLEQRFAYPVFIENDVRALASFELLFGEGVGVDQFFYLYAGEGIGG
FT                   AYVLDGKLIDGENHITGEVGHMRLDLDGPICSCGNRGCLEALAGEKALLRDFEAVDPQV
FT                   KTLTELRRRLTDQDPHATAAYHRAGEYIGIGVLNTIHLINPKRILLGGPMFELAPSIVD
FT                   QIKERVEHTALTTASRETDVKMVPWSEKQGALSAAALATNSIFQTI"
     atggtgaaag agatgccacg aaattcaaag tggatgcgtt cctacaatcg ggcacttgta        60
     ttacgtttga ttcggatgca tcaaccgatt tcacgggtgg aactggcaca acagacaaaa       120
     ttgacgaaac cgaccgtttc gaatatcgtc ggagaattga ttgcggatca actcgtgatg       180
     gagcgtgaac tcggtgtctc aaacggagga cggaaaccga ttttactcga actcgtggcg       240
     aaagaacaat acgtcatcgg gatcgatgca accagtcacc gttttatcgg cgtcatcgcg       300
     gatttaagcg ggaatacgat tcacgaagtg gaaacgatgg ggaaatttga tacgaatgaa       360
     gaattaatgg aagctgtcgt tcaattgtgt caacaattga ttgacgcaac cgatcaggtc       420
     ggaacgattc atggaatcgg tatatccgtt cacgggatgg ttaatccgga gaccggggtc       480
     attctgtttg ctccccgttt tcacctccat gatgtcgcct taaaagaaca tttggaacag       540
     cgttttgcgt atccggtgtt cattgaaaat gatgtccggg cactcgcttc gtttgaattg       600
     ttattcggag aaggcgtcgg ggtcgaccaa tttttctatt tgtatgccgg agaaggaatt       660
     gggggagcat atgtccttga cgggaaactg attgacggcg aaaatcatat taccggtgag       720
     gtcggacata tgcggcttga tttggacgga ccaatctgtt cctgcggtaa ccgtggctgc       780
     cttgaagcat tagccggtga gaaagcgtta ttacgtgatt ttgaagctgt tgatccgcaa       840
     gtcaagacgt taacggaact ccggcgacgc ttgacggacc aggatccgca tgcgacggcg       900
     gcatatcaca gggcgggcga gtatatcgga atcggtgtcc tgaatacgat tcatctgatc       960
     aatccgaaac gtattttact cgggggcccg atgttcgaac tggcaccatc cattgtcgat      1020
     caaattaaag aacgggtcga gcacacggct ttgacgaccg cttcacgtga aaccgacgtc      1080
     aagatggttc cttggagtga aaaacaaggg gcactcagtg cagcagcact cgcgacaaac      1140
     agtatttttc aaacgattta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page