(data stored in ACNUC7421 zone)

EMBL: CP001022.PE367

CP001022.PE367       Location/Qualifiers
FT   CDS_pept        391862..392323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59855"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH2"
FT                   /protein_id="ACB59855.1"
FT                   /translation="METEDLWVSYREAFGRYGAIRGFYVNRLTGDMTEQQPGDKRSADQ
FT                   DGVLVRPRQDGVFQFRMSSVQGVLTIRSSELHLRKNENGYIELRVLMQHMRTAGCLTLG
FT                   GEFYLFVTPEVDTLDYRLRLIARVLIQLQRMPIGMEVIEQWCQHAQLEG"
     atggaaacag aggatttatg ggtttcctac cgtgaagctt tcgggcgtta cggagcaatc        60
     cgtggctttt acgtgaaccg tttgacagga gatatgacgg aacaacagcc gggagataag       120
     cggtctgcag atcaggacgg cgttctcgtt cggccacgac aagatggagt ctttcaattt       180
     cgaatgtcgt ccgtacaagg ggtactgacg attcggtctt cagaacttca tcttcgaaaa       240
     aatgagaacg gatacatcga gttacgggtg ttgatgcaac atatgcgcac agccggttgt       300
     ttgacgctcg gtggagaatt ttatctgttc gtgacaccgg aagtggacac gctcgactat       360
     cgtctacgac tgattgcacg ggtcttgatt caactccaac ggatgccgat tggcatggaa       420
     gtcatcgaac aatggtgtca acacgcacag cttgaagggt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page