(data stored in ACNUC7421 zone)

EMBL: CP001022.PE368

CP001022.PE368       Location/Qualifiers
FT   CDS_pept        392374..393684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0372"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2544 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59856"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH3"
FT                   /protein_id="ACB59856.1"
FT                   /translation="MKFKKTKVLAAASVLTLSALLAACGGEDEKQATTKDGKTIISWWG
FT                   WAPQPEAGKEVVDAFNKSQDKYVVEFKRYSEDYEKQLQVAMLSGKGPDIIGLKEPMIQQ
FT                   YKDRVVPVDSYMDKAAGKGWKDKFVELGIDQTTIDGKQYAVPIGFTGQAYLMYNKTMLD
FT                   KYGVTPPKNYKETVDAVKKIKASGDKVIPLMLGAKDAWIDIDVYNVLSHQVAPGYIQKV
FT                   LSGEAKWTDDEMVKTAQIWQDLFEKKVFQEGALGLATYNDGMNQFFDKKAAMWVIGSWE
FT                   AHSMTTAEKKDKWKIKDELGFTPLPNLAGGTEQPIIASIDMALAVNKESKQQEGAAEFV
FT                   AFMSQGKGQEVYMGEFEMAPGIKDVKIDSDAAFTSEGEKESYKMLNETLSKAVASRGIR
FT                   DTKLNDILGKELQNIATGQNPKEALQRVQDAADQSKK"
     atgaaattca aaaaaaccaa agtacttgca gccgcatcag ttctgacatt atcggcactt        60
     ctcgctgctt gtggcggcga agatgaaaaa caagccacaa ccaaagacgg caaaacaatc       120
     atttcctggt ggggttgggc acctcagcct gaagccggta aggaagtcgt cgatgccttc       180
     aacaaatcac aggacaaata cgtcgtcgaa ttcaaacggt acagtgaaga ttacgaaaag       240
     caacttcaag tcgcgatgtt atctggtaag ggaccagaca tcatcggctt aaaagaacca       300
     atgattcaac aatacaaaga ccgtgtcgta ccggtcgatt cttacatgga taaagcagcc       360
     ggcaaaggat ggaaagataa attcgttgag ctcggaattg atcaaacgac gattgacggc       420
     aaacaatatg cagttccaat cggatttacg gggcaagcct acttgatgta caacaaaacg       480
     atgcttgata aatacggcgt aacaccaccg aaaaactaca aagaaacagt cgacgctgtc       540
     aagaaaatca aagcgtccgg cgataaagtc attccattga tgctcggtgc aaaagatgct       600
     tggatcgaca ttgatgtcta caacgtatta agccaccagg tagcacctgg ttacatccaa       660
     aaggtcttat ctggcgaagc gaaatggaca gacgacgaga tggtcaagac agcgcaaatc       720
     tggcaagatc tgtttgaaaa gaaagtcttc caagaagggg cactcggact tgcgacatac       780
     aatgacggga tgaaccaatt cttcgataaa aaagcagcga tgtgggtcat cggttcgtgg       840
     gaagcccact cgatgacgac agctgagaaa aaagacaaat ggaaaatcaa agacgagctt       900
     ggcttcacac cacttccaaa ccttgcaggc ggaacagaac agccgatcat cgcttccatc       960
     gatatggcgc ttgccgtcaa caaagaatca aaacaacaag aaggtgcagc tgaattcgtt      1020
     gccttcatga gccaaggtaa aggacaagaa gtttacatgg gcgagttcga aatggcaccg      1080
     ggaatcaagg atgtcaaaat tgattcagat gcagccttca catctgaagg ggaaaaagag      1140
     tcgtacaaaa tgcttaacga aacactttct aaagctgtag caagccgtgg tatccgtgat      1200
     acaaaactga acgatatcct cggtaaggaa cttcaaaaca tcgcgacggg tcaaaatccg      1260
     aaagaagcac tccaacgtgt tcaggatgca gccgatcaat cgaaaaaata a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page