(data stored in ACNUC7421 zone)

EMBL: CP001022.PE37

CP001022.PE37        Location/Qualifiers
FT   CDS_pept        53901..54761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0038"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: bsu:BSU00460
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59525"
FT                   /db_xref="GOA:B1YGP2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGP2"
FT                   /protein_id="ACB59525.1"
FT                   /translation="MTIIVKAPAKINLVLDATAKRPDGYHDVHMVMTTVDLADRLELTE
FT                   LASGEIRMNAQHAYVPNDERNLAYKAAAVLKERFDIKSGVEIYLEKQIPVAAGLAGGSS
FT                   DAAATLRGLNELWKLNLTLEQLAEIGSEVGSDVPFCVMGGTAIATGRGEKLEKLVSPPP
FT                   CWVVLAKPTIGVSTADVYGALDLETAERPDVGAMIDAVKNQDFTAICESLGNVLESVTL
FT                   PMHPEVEQIKAFMTSCGAEGVLMSGSGPTVFALTEHENRAQRLYNGLRGFCNEVYVVRL
FT                   LGENH"
     atgacgatta ttgtaaaagc tccagcgaaa atcaatttag tattggatgc gacggcgaaa        60
     cgtccggatg gttatcatga tgtacatatg gtgatgacga cggtggattt ggcagatcgt       120
     ctcgaattga cggaattagc gtccggcgag attcggatga atgcccaaca tgcttacgta       180
     ccaaatgatg aacgcaactt agcgtataaa gcagcagcgg ttttaaagga acggttcgac       240
     atcaagagcg gggttgaaat ctacttagaa aaacaaatcc cggtcgcagc aggtcttgcg       300
     ggcggctcga gtgacgcggc cgcaacactg cgtggactga atgaattatg gaagctcaac       360
     ctgacgcttg aacagttggc ggaaatcgga tcagaagtcg gatcggatgt cccgttttgt       420
     gtcatgggtg gcaccgcgat tgccacgggg cgcggggaaa agctcgagaa attagtctct       480
     cctccgcctt gttgggttgt actggcgaaa ccgaccatcg gtgtctcgac agcagatgtg       540
     tacggagcgc ttgatttgga aacagcggaa cgtccggatg tcggagcaat gatcgatgcg       600
     gtcaagaacc aagatttcac ggccatttgt gaatcgctcg gcaatgtcct tgaatccgtg       660
     acattaccga tgcatccgga agtcgaacaa atcaaagcgt tcatgacaag ttgtggagca       720
     gaaggtgtct tgatgagcgg cagcggtccg accgtttttg ctttgacgga acacgaaaat       780
     cgggcgcagc gtctctataa cggattacga ggattttgta atgaagtcta cgtcgttcgt       840
     cttttagggg aaaaccattg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page