(data stored in ACNUC7421 zone)

EMBL: CP001022.PE371

CP001022.PE371       Location/Qualifiers
FT   CDS_pept        395550..397544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0375"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: lic:LIC10031
FT                   beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59859"
FT                   /db_xref="GOA:B1YIH6"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH6"
FT                   /protein_id="ACB59859.1"
FT                   /translation="MYLGVDYYPEQTPRALWEEDFRLMKELGVNVVRLAEFAWTMMEPE
FT                   EGVYDFRFWDDIIERLSAAGFDIVLGTPTATPPAWMCHKYPEILPADEHGVTISFGARR
FT                   HYTVHSETYQRFSVAITTEMAKRYGKHSRVIGWQTDNEYGHEKSDRSYSDVDRAAFQVW
FT                   LKNRYGTLDALNETWGTVFWSQIYTAWEQIPVPRKVYQEHNPSLLVDFDRFCADGYNHY
FT                   NKLQVDALREHIHPEAFITHNLVYSDMAVNQQQMAQDLDYVAFDNYPVWGGLPEPNRFE
FT                   KMASDHDLCRSSKQGKGFWVMEQLSGAQGWSKIGYLPRPGHIRLWTYQAVARGAEAIVY
FT                   FRFRAALFGTEEFCHGIIDHDGKPKRKFNEVKQIMTELNTFGDEINASSYRAEVGVYFD
FT                   QENVWAWTHQPHSDAFDFRTEFVRFYGGAVRRQASTDIVFPGDKLDQYKLIIVPLYFLT
FT                   NPTFDQALIDYMEQGGHVIFTYRTGVKDPHNNVLPLTLPGQFATYAGIEIDEYESLQAV
FT                   QENRVEGIGKFAGQGSPARLWCDLITPTTAEPLAVYRDTFYDGVAAVTRNEYKGMITYI
FT                   GASIDDAMIDTIYRQAFLDAGVQTFEAPDQVEIVRRHGETRDFLFLMNHDTKASRDVVL
FT                   DAAYQELNTNETYSGTVTLAPLETLILTT"
     atgtatttag gcgtcgatta ttacccggaa caaactccac gtgcgttatg ggaggaagac        60
     ttccgattga tgaaagaact tggtgtcaac gtcgttcggt tggcggaatt tgcctggacg       120
     atgatggagc cggaagaagg agtttacgat ttccggtttt gggacgatat catcgaacgc       180
     ttgagtgccg ccggttttga catcgtcctc gggacaccga cggcaacacc accggcctgg       240
     atgtgtcaca agtatccgga gattcttccg gcagacgagc acggcgtgac aatcagtttc       300
     ggagcccgtc gccattatac ggttcacagc gaaacgtacc aacgtttttc cgttgccatc       360
     acgacagaaa tggcgaaacg ctatggaaaa cactcgcgtg tcattggttg gcagacggac       420
     aacgaatacg gtcatgagaa atcagaccgt tcctacagcg atgtcgaccg ggctgctttc       480
     caggtctggc tcaaaaaccg ttacggcacg ctcgatgcgt taaatgaaac atggggaacc       540
     gtcttctgga gtcaaatcta tacggcatgg gagcaaatcc cggtgccgcg gaaagtctat       600
     caggaacaca atccatcgtt acttgtcgac ttcgaccgtt tctgtgccga cggttacaac       660
     cattacaaca aactgcaagt cgatgcgctc cgggaacaca tccatccgga ggccttcatt       720
     acccataacc tcgtgtacag cgacatggcc gtcaatcagc agcagatggc acaggatctt       780
     gattatgtcg cctttgataa ctatccggtc tggggcggtt tgccggaacc gaaccgtttc       840
     gagaagatgg cgagcgatca tgacctttgc cgctcctcaa aacaagggaa aggtttttgg       900
     gtgatggagc agctcagcgg agcgcaaggc tggagcaaaa tcggttactt gccgcgcccg       960
     ggacatatcc ggttgtggac gtatcaggct gtcgcgcgcg gtgccgaagc gatcgtctat      1020
     ttccgtttcc gggcggcgtt gttcggaacg gaagagtttt gtcatgggat catcgatcac      1080
     gacggaaaac cgaagcgtaa attcaacgaa gtcaaacaaa tcatgaccga actgaacacg      1140
     tttggtgacg agattaacgc gagtagctat cgggcggaag tcggcgtgta tttcgatcaa      1200
     gaaaacgtct gggcctggac ccatcagccg cacagtgatg cgtttgattt ccggaccgag      1260
     ttcgtccgtt tctacggtgg tgccgtccgg cgtcaagcgt cgacggatat cgtcttcccg      1320
     ggagacaaac tggatcaata taaattaatc atcgttccgc tgtacttcct gacgaatccg      1380
     acattcgatc aagcgttaat cgattacatg gagcagggcg gacacgtcat cttcacgtac      1440
     cggaccggcg tcaaggatcc gcacaacaat gtcctgccac tgacgttgcc tggtcagttc      1500
     gcaacgtatg ccgggattga aatcgatgag tacgaatcgt tgcaagccgt gcaggaaaac      1560
     cgggtggaag ggatcggaaa attcgcggga caaggctcac cggcccgtct ctggtgtgat      1620
     ttgattacac cgacgacagc cgaaccgctt gctgtctacc gcgatacgtt ttatgacggc      1680
     gtcgctgccg tgacacgcaa cgaatacaaa ggaatgatta cctatatcgg cgcatcgatt      1740
     gacgatgcga tgatcgatac gatttaccgt caagcgtttc tcgatgccgg tgttcaaacg      1800
     tttgaagcac cggatcaagt cgagattgta cgccgtcatg gtgagacacg tgatttcctc      1860
     ttcctgatga atcacgatac gaaagcaagc cgggacgttg tgctcgatgc tgcctatcaa      1920
     gagttgaata cgaacgagac atatagtgga acagtgacgc tcgccccact cgagacgctg      1980
     attctgacaa cgtaa                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page