(data stored in ACNUC7421 zone)

EMBL: CP001022.PE374

CP001022.PE374       Location/Qualifiers
FT   CDS_pept        400861..401859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0378"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: bld:BLi04283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59862"
FT                   /db_xref="GOA:B1YIH9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH9"
FT                   /protein_id="ACB59862.1"
FT                   /translation="MAVLVVGGAGYIGSHAVYQLVDAGQDVVVIDHLKSGHREAVHPKA
FT                   RFYEGDIRDRAFLDTVFEKETIDQVVHFAAFSLVGESMEHPLAYFDNNVYGTQVLLEAM
FT                   MAHDVKQIVFSSTAATYGEQEQMPILETATTNPTNAYGETKLMMEKMMRWCETAYGLNY
FT                   VALRYFNVAGARATGEIGEDHTPETHLVPLVLEVANGQRPVISIYGDDYATEDSTCIRD
FT                   YIHVEDLIDAHLLALEYLKQGNTSDVFNLGSSRGFSVREIIEAARRVTGHAIPEQVVAR
FT                   RAGDPSTLIAGSDKAKKVLGWTPRRTEIDTIIQDAWRWHEQRPQGYKTPVR"
     atggcagtac tcgtagtagg tggagcagga tatataggat cacacgcagt ctatcaactg        60
     gtcgatgccg gacaagatgt tgttgtcatc gatcatttaa aatcgggaca ccgggaagcg       120
     gttcatccga aagcccgttt ttacgaaggg gatattcggg atcgtgcttt ccttgacacg       180
     gtgtttgaga aggaaacaat cgatcaggtc gtacattttg cggccttttc gttagtcggc       240
     gaatcgatgg agcacccgct cgcttatttt gataacaatg tctacggcac acaagtgttg       300
     ctcgaagcca tgatggcaca tgacgtgaag caaatcgtct tctcgtcgac agctgcgaca       360
     tacggtgaac aggaacagat gccgattctt gagacggcca cgacgaatcc gacgaatgct       420
     tacggtgaaa cgaagctgat gatggagaag atgatgcgtt ggtgtgaaac ggcatatggt       480
     ctgaactatg tcgcgctccg ctactttaat gttgccggag cacgcgcaac gggtgaaatc       540
     ggagaagatc atacaccgga aacccacctg gttccgcttg tcctcgaagt cgccaacggg       600
     cagcggccgg tgatttcgat ttacggcgat gattatgcga cggaagatag cacgtgtatc       660
     cgtgactata tccatgtcga ggatttaatc gatgcccacc tgttggcact ggaatattta       720
     aaacaaggca acacgagtga cgtctttaat ctcggttcaa gccgcggctt ttcagtccgg       780
     gaaatcattg aagcggcacg ccgtgtaacg ggacatgcga ttccggaaca ggttgtcgca       840
     cgacgcgccg gagacccgag tacattgatt gcgggatctg ataaagcgaa aaaggttctc       900
     ggctggacac cgcgccggac agaaatcgac accatcattc aagatgcatg gcgttggcat       960
     gaacagcgtc cgcaaggcta caaaacacct gtacggtaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page