(data stored in ACNUC7421 zone)

EMBL: CP001022.PE377

CP001022.PE377       Location/Qualifiers
FT   CDS_pept        complement(404824..405345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0381"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: methylguanine DNA
FT                   methyltransferase ribonuclease domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; KEGG: bsu:BSU01820 O6-methylguanine-DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59865"
FT                   /db_xref="GOA:B1YII2"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII2"
FT                   /protein_id="ACB59865.1"
FT                   /translation="MEVYFTRLNWNDTSFPIAASETGLCYVGALNEPSDLFDDWIRKHL
FT                   PRAELIEHPRIMQPYQEQLLEYLNGVRTRFSLPLHLIGTPFQLEVWQALCQVPYGVTVT
FT                   YSDIAKQIYRPGATRAVGTAISKNRVLIVVPCHRIVGKKGDLTGYWGGLNMKRQLLEIE
FT                   QVSSSKLPFL"
     atggaagtct actttacacg gttgaactgg aacgacacat cctttcccat tgcggcatcg        60
     gaaaccggac tctgttatgt cggtgcgtta aatgaaccgt cggacttatt tgacgactgg       120
     atccgaaagc atttaccccg ggctgaactg attgagcatc cacgtatcat gcaaccatac       180
     caggaacaac ttcttgaata cttaaacggg gtacggaccc ggttttccct cccgctgcat       240
     ttgatcggta caccctttca attggaagtc tggcaggctt tatgtcaggt tccgtacggt       300
     gtgacggtga cgtactccga tatcgctaag cagatctatc gaccgggtgc gacgcgtgct       360
     gtcggaacag ccatcagtaa aaatcgtgtc ctaattgtcg ttccctgcca ccgcatcgtc       420
     ggcaaaaaag gcgacttaac cggttactgg ggcggtctga acatgaaacg tcagctgttg       480
     gagatcgaac aggtctcgtc ctcgaaactc cctttcctgt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page