(data stored in ACNUC7421 zone)

EMBL: CP001022.PE378

CP001022.PE378       Location/Qualifiers
FT   CDS_pept        complement(405423..406823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0382"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; HI0933 family protein;
FT                   KEGG: bha:BH0216 pyruvate dehydrogenase E3
FT                   (dihydrolipoamide dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59866"
FT                   /db_xref="GOA:B1YII3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII3"
FT                   /protein_id="ACB59866.1"
FT                   /translation="MVVGELTQERDLVILGGGPAGYTAAIRASQLGRTVTLIEQAQIGG
FT                   LCLNKGCIPSKVVAHAAEVKLQTKHMTALGFSFHPTHDFSQLVEYRERTIRQLRTGVEA
FT                   LCQANAIEVVHGTASFLADDRIGVELGHQFDTYRFNDVVIATGSHSIKQDAPSVLNAEQ
FT                   LYQLTELPERLVIIGQDYIAIEAAMSFQALGTSVTLIADAFDFDPSLDKELRRLFKKQK
FT                   IQLVTGTVTAIEAQEDVTVTVVKQGQETTWSAPFLFHSLPRVPHTLELGLERIGVTLAE
FT                   DGTIPVDPFGQTNRPHIYAIGDVTPGPAIATRAIHEAKRTAEHLSGQSADTTVPYYPTI
FT                   IRSLPPIVSIGLTEQTATDAGHSFRTAQFALNANGATTIEGGSGFIKVISDATTSLILG
FT                   IHMIGEGAIELAGVFAQTLELHAKEEDVRFPVMPHPSRNEAFTEAIEALLGQAIHLPPR
FT                   QQDVLAKS"
     atggtcgtag gtgaactgac gcaagaacgt gatttagtga ttcttggcgg tggtccagcc        60
     ggttacaccg ctgcgatccg tgccagtcaa ttgggtcgaa ccgtcacttt gattgaacag       120
     gcacaaatcg gcggactttg tttgaacaaa ggatgtattc cgtctaaagt cgttgctcat       180
     gccgcagaag tcaaactgca aacgaaacat atgactgctc tcggcttctc gtttcatccg       240
     acacatgatt tcagtcaatt ggtcgagtac cgggaacgga ccatccgtca attacgaacc       300
     ggagtcgaag cgctctgtca ggccaacgca attgaagtcg ttcacggaac ggcttccttc       360
     ttggcggatg accggatcgg tgtcgagctc gggcatcagt ttgatacgta ccggtttaac       420
     gatgtcgtga ttgcgaccgg cagtcacagc atcaagcaag atgccccttc cgtactgaat       480
     gccgaacagt tatatcaatt gaccgagtta cccgaacgtc tcgtcatcat cggacaggac       540
     tatatcgcga tcgaagccgc catgagtttt caagccctcg ggacgtcagt cacactgatt       600
     gcagatgcat tcgattttga tccgagtctc gacaaagagt tgcggcgtct ctttaaaaaa       660
     caaaaaatcc agttggtcac cggtaccgtc acggcaatcg aagctcagga ggacgtgacc       720
     gtgactgttg tcaaacaggg gcaggaaacg acctggtccg ctcctttcct gtttcactcg       780
     ttaccccggg ttccgcatac attggagctt gggcttgaac gaatcggtgt gacgttagca       840
     gaagacggaa cgattcccgt cgatccattc ggacagacga accgtcctca catttatgcc       900
     atcggcgatg tgacacccgg tcccgctatt gcaacacgtg ccatccacga ggcaaaacgg       960
     accgctgaac atctgagcgg acagtcggct gatacgacgg ttccctatta tccgaccatc      1020
     atccgctccc ttccgcccat tgtctcgatc ggcttgacgg aacaaacggc gacagacgcc      1080
     ggtcattcgt tccggaccgc gcagttcgca cttaacgcca atggagcgac gaccatcgaa      1140
     ggaggtagcg gattcatcaa agtgatttcc gatgcgacga ccagtctcat cctcggtatt      1200
     catatgatcg gcgaaggtgc gatcgaattg gccggtgtct ttgctcagac gcttgaactg      1260
     catgcgaaag aagaagacgt ccgcttcccg gtcatgccgc atccaagtcg aaacgaagcc      1320
     tttacggaag ctatcgaagc cttgctcgga caggcaattc atttaccgcc tcgtcagcag      1380
     gatgtcttag cgaagtcgta a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page