(data stored in ACNUC7421 zone)

EMBL: CP001022.PE380

CP001022.PE380       Location/Qualifiers
FT   CDS_pept        complement(408051..409049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0384"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: gtn:GTNG_1911 pyruvate decarboxylase
FT                   beta subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59868"
FT                   /db_xref="GOA:B1YII5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII5"
FT                   /protein_id="ACB59868.1"
FT                   /translation="MATPINRQTEMTLVQAVTDALRTKLTDDETTLVLGEDVGKNGGVF
FT                   RATDGLQEEFGEDRIIDTPLSEAGIVGTSIGLAVNGFKPIVEIQFLGFIYPAYEQIMTH
FT                   VSRIRMRTMGRYGVPMVIRAPYGAGIRAPEIHSDSTEALFTSMPGLKVVCPSTPYDAKG
FT                   LLIAAIEDPDPVLFLESMRSYRAFKEPVPSEAYTIEIGKANCITEGQDVTLIAWGAMVQ
FT                   VAQKAATEAATRGISCEVIDLRTLYPLDRETISASVQKTGRAVIIHEAQATGGLGNDLL
FT                   ALINDTSFLYLRAPVARVTGFDVPVPLFALEDHYIPTPTRVLEAIQRTVDF"
     atggcgacac ctatcaatcg gcaaacagag atgacgcttg tccaggctgt caccgatgct        60
     ttacggacaa aactgacgga cgatgagacg acgcttgtac tcggagaaga tgtcggaaaa       120
     aacggcggtg tcttccgggc aacggacggt ttgcaggaag agttcgggga agaccggatc       180
     atcgatacgc cgcttagtga agccggcatc gtcggaacat cgatcggtct cgcggtcaac       240
     ggatttaagc cgattgtcga aatccaattt ctcggtttta tctatcctgc ttacgaacag       300
     atcatgaccc acgtctcacg gatccggatg cggacaatgg gacgttacgg tgtaccgatg       360
     gtcatccgtg caccttatgg agccggcatt cgggcaccgg aaatccattc cgacagtacg       420
     gaagcgctgt ttacttcgat gcccggcctg aaagtcgtct gcccttcgac gccgtatgat       480
     gcgaaaggat tattgattgc cgccattgaa gatccggacc cggtcctgtt cctcgagtcg       540
     atgcggagtt accgggcctt taaggagccg gttccgagtg aagcgtatac gattgaaatc       600
     ggtaaagcca actgcatcac cgaagggcag gacgtgaccc tgattgcctg gggagcaatg       660
     gttcaagtcg cacaaaaagc cgcgacggaa gccgcgaccc gtggtatctc ctgtgaagtg       720
     attgatttac ggacccttta tccgctggat cgtgaaacga tttcagcatc ggtccaaaaa       780
     accggccggg ctgtgatcat tcatgaagcc caggcaacgg gtggtcttgg aaatgatctg       840
     cttgcgctga tcaacgatac ttcgttctta tatttacggg caccagttgc ccgcgtcacc       900
     gggttcgacg ttcctgttcc attattcgcc ctggaggacc attacatccc gacgccgacg       960
     cgtgtgcttg aagcgatcca gcgtacggtc gatttttaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page