(data stored in ACNUC7421 zone)

EMBL: CP001022.PE381

CP001022.PE381       Location/Qualifiers
FT   CDS_pept        complement(409051..410103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0385"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: gtn:GTNG_1912 pyruvate decarboxylase alpha
FT                   subunit-like protein; TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59869"
FT                   /db_xref="GOA:B1YII6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII6"
FT                   /protein_id="ACB59869.1"
FT                   /translation="METEFPIYRILDDAGQVTDTSKTDLLTKDLSLALFTHMNRIRTFD
FT                   RKAINLQRQGRLGTYAPFEGQEAAQVGSAYALQDKDWVFPTYRDHGATLTFGADMVRTF
FT                   LYWNGRVEGCVATDELHIFPPAVPIATQIPHAVGAAWAEKRKGSTQVAVAYFGDGATSE
FT                   GDFHEGMNFASVFQAPVILFNQNNGYAISVPIQKQMHSETIAQKALAYGMPSVRIDGND
FT                   VFAVYFTMQKALERARSGGGPTLIEAVTWRFGAHTTADDPSKYRDQERSRDRVDPLERL
FT                   EAFMKEQGFYDEQEIETIRSRHQEEVEAAVKTMESFPPPDVNDLFDHTFATLPDDLVRQ
FT                   KTDYLTARGN"
     atggaaaccg aatttccgat ttaccggatc cttgatgatg cgggacaagt gacggataca        60
     tctaaaaccg atttgctgac aaaagacttg agcctcgcct tatttacaca tatgaaccga       120
     atccggacgt ttgaccggaa agcgatcaat ctccaacgtc aagggcggct tggcacctat       180
     gcaccgttcg aaggacagga agccgcacag gtcggcagtg cgtatgcgtt gcaggacaaa       240
     gactgggtct tcccgacata ccgggatcac ggagcaacac tgacgtttgg cgccgacatg       300
     gtccggacgt tcttatattg gaacggacgc gtcgaaggct gtgtcgcgac ggatgagttg       360
     catatctttc cacccgctgt tccgatcgcc acacaaattc cgcacgcagt cggtgcggca       420
     tgggcggaaa aacgaaaagg atcgacccaa gttgccgtcg cttactttgg cgacggagcg       480
     acgtcggaag gtgattttca tgaaggcatg aatttcgcca gcgtcttcca ggctccggtg       540
     atcctgttta atcaaaacaa cggctatgcg atttccgtcc cgattcaaaa acagatgcat       600
     tcggaaacga ttgcccaaaa agcattggca tacggtatgc caagtgtacg gattgacggc       660
     aatgacgtgt tcgccgtgta tttcacgatg caaaaagcac tggagcgggc ccgttccggt       720
     ggcggtccga cattgatcga agccgtcacg tggcgcttcg gtgcccatac gacggcggac       780
     gatccgtcga aataccgcga tcaggaacgc tcccgggacc gagtggatcc tctcgagcga       840
     ctagaagcat tcatgaagga acagggcttt tatgatgagc aggagatcga aacgattcgg       900
     tcccgtcatc aggaagaagt cgaagccgcc gtcaagacga tggaatcctt cccgccgcct       960
     gacgtcaatg atttatttga ccatacgttt gcaacattac cggacgattt agtccgtcaa      1020
     aaaacggatt atctgactgc aagggggaat taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page