(data stored in ACNUC7421 zone)

EMBL: CP001022.PE383

CP001022.PE383       Location/Qualifiers
FT   CDS_pept        complement(411304..411699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59871"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII8"
FT                   /protein_id="ACB59871.1"
FT                   /translation="MKNGLSLGDSAVIETTVTEEMFAQFEGVVVHPAYSTVSMVYHMEW
FT                   AARKLILPYLEEQEEGVGGAVSLKHVGMATLGSNIRIEAVVSELTPGRVLAKVEVRHGN
FT                   RVIGLGEVKQIILNKQLIQEKLTPHVF"
     gtgaaaaacg gtttgtcgct cggcgactct gcggtgatcg agacgactgt cacagaagaa        60
     atgtttgcac agtttgaggg tgtggttgtc catcccgcct attcgaccgt ctcgatggtc       120
     tatcatatgg aatgggctgc ccgaaaactc atccttcctt atctggaaga acaggaggaa       180
     ggtgtcggtg gagctgtttc cttaaagcat gtaggaatgg cgacactcgg atcgaatatc       240
     cggattgaag ccgttgtcag tgagcttacc ccgggtcgcg tattggcaaa agtcgaagtc       300
     agacacggca atcgtgtcat cggtcttggg gaagtcaaac agattatctt aaataagcag       360
     ctgattcagg aaaagttgac gccgcatgtt ttttga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page