(data stored in ACNUC7421 zone)

EMBL: CP001022.PE386

CP001022.PE386       Location/Qualifiers
FT   CDS_pept        414323..414667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0390"
FT                   /product="phenylacetate-CoA oxygenase, PaaH subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaH subunit;
FT                   PFAM: phenylacetic acid degradation B; KEGG: gtn:GTNG_1928
FT                   phenylacetic acid oxygenase complex B"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59874"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ1"
FT                   /protein_id="ACB59874.1"
FT                   /translation="MTETFYQEFEVFSKRTPNAAFTHQFSLLAPNKEMALLMAQENFMR
FT                   REPVVDIWVVKRADIRGMTPDEKLMLQRLDNKDYRTTKGYGYLKKKWRHYEQQMLDEKE
FT                   IMSWQGGDSK"
     atgacggaaa cgttttatca agagttcgaa gtgttcagta aacggacgcc gaatgcagcc        60
     tttacgcatc agttcagttt actggcaccg aataaagaga tggctctact gatggcgcag       120
     gaaaatttca tgcgccgcga accggtcgtc gacatctggg tcgtcaaacg ggccgatatc       180
     cggggaatga caccggatga aaagctgatg ctgcaacggc tcgacaacaa agattaccgg       240
     acgacgaaag ggtacggtta cctgaagaaa aaatggcgtc attatgagca acagatgctc       300
     gatgaaaaag aaatcatgtc ctggcaagga ggcgattcga aatga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page