(data stored in ACNUC7421 zone)

EMBL: CP001022.PE387

CP001022.PE387       Location/Qualifiers
FT   CDS_pept        414664..415449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0391"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaI subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   gtn:GTNG_1927 phenylacetic acid oxygenase complex C"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59875"
FT                   /db_xref="GOA:B1YIJ2"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ2"
FT                   /protein_id="ACB59875.1"
FT                   /translation="MTETERLALASLLYQLADDDFLYAYRGSEWLGLAPHIEEDVASSS
FT                   IAQDSMGHAAMYYQLLEEIGEGKADALAHVRLAHERKNSVLVERVNGPGYYMENPEYDW
FT                   AYAVVRNYCYTLAKKVRIDSLKKSSYTPLAALAVKVNMELYYHLLHWQTWFTQLYQSTE
FT                   TARQKMDAALERVLADFGDLFDYGEASELIDEMRLIEGQGILLDRWYQALTPVLVDLNV
FT                   TLPEMKMTYNGRNGEHSPDLNDALSTLGEVYLLDQSAVW"
     atgacggaaa cagaacgttt agcgttggct tcactgctct atcaactggc ggatgatgac        60
     tttttatacg cctaccgggg atcagagtgg ttagggctcg ctccgcatat cgaagaagat       120
     gtcgcgtcat cctcgattgc ccaggattcg atggggcatg cggcgatgta ctatcagctg       180
     cttgaagaaa tcggagaagg aaaagccgat gcactcgcac acgtccggct tgcgcacgaa       240
     cggaaaaact ccgttctcgt cgaacgcgtc aacggaccgg gctattatat ggaaaacccg       300
     gaatacgact gggcctacgc cgttgtccgc aactattgtt acacgctcgc gaaaaaggtt       360
     cggattgatt cgttgaaaaa aagcagttat acgccgcttg cggccctcgc cgtcaaggtc       420
     aacatggagt tgtattatca tctgctgcac tggcagacgt ggttcaccca gctgtatcaa       480
     tcgacggaaa cagcccgtca gaaaatggat gcggcgcttg aacgggtgct ggcagacttc       540
     ggtgatctgt ttgattacgg ggaagcgtca gaactgattg atgaaatgcg gttgattgaa       600
     ggtcagggga ttttactgga tcgctggtat caggcactga cgccggtgct cgtcgatcta       660
     aacgtcacgt tgccggaaat gaagatgacc tacaacggac gaaacggtga gcactcgcct       720
     gatttgaacg atgccttatc gacgctcggg gaagtgtatc tgctcgatca gtcagcggta       780
     tggtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page