(data stored in ACNUC7421 zone)

EMBL: CP001022.PE389

CP001022.PE389       Location/Qualifiers
FT   CDS_pept        415974..416297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0393"
FT                   /product="Ethyl tert-butyl ether degradation EthD"
FT                   /note="PFAM: Ethyl tert-butyl ether degradation EthD; KEGG:
FT                   bha:BH0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59877"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ4"
FT                   /protein_id="ACB59877.1"
FT                   /translation="MVKLIALYTHPENKEQFDEHYFNVHGPLTAKIPGLQQMTVTKIVG
FT                   SPMGGDGKYYLMCEMVYESHETMKAGMRSLEGKASGKDLMGFAGDLVTLMIGEEVHADA
FT                   TVR"
     atggtaaaac taatcgcgct ttatacacat ccggaaaaca aggaacagtt tgacgagcat        60
     tactttaatg tccatggtcc gctgacggcc aagattcccg gtctgcaaca gatgacggtc       120
     acgaaaatcg tcggttcacc gatgggcgga gacgggaaat attatctgat gtgcgaaatg       180
     gtctacgaaa gccatgaaac gatgaaagcc ggcatgcgtt cgcttgaagg gaaagcatcc       240
     gggaaagatt tgatgggctt tgcgggagat cttgtaacgc tgatgattgg tgaagaagtc       300
     catgctgacg ccacagtacg ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page