(data stored in ACNUC7421 zone)

EMBL: CP001022.PE399

CP001022.PE399       Location/Qualifiers
FT   CDS_pept        424593..425072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0403"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1773 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59887"
FT                   /db_xref="GOA:B1YIK4"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK4"
FT                   /protein_id="ACB59887.1"
FT                   /translation="MGLGMFCAIVAGMMISLQTVLNARMSHAFGAWATTTLVFFVGLLG
FT                   SLLALIFFRGGTLAGLAEVEPLYLFGGFVGVGVVFCVMRGIQLLGPSIAISVVLISQLS
FT                   FALCVDVFGWFGLPKVELSFGQIIGLAVMLSGIFVLKRYQVAEDTEEVEDVKVIS"
     atgggactcg gaatgttttg tgccatcgtc gcaggaatga tgatcagttt acagaccgtt        60
     ttaaatgcac ggatgagtca tgccttcggt gcttgggcga cgacgacatt agtctttttt       120
     gtcggactgc tcgggtcgtt gctcgcattg atcttctttc ggggtggaac gcttgcgggg       180
     ctggccgaag tcgaaccgct ttatctgttt ggcggtttcg ttggtgtcgg ggttgtcttt       240
     tgtgtcatgc ggggaattca gttgctcgga ccgtcgattg cgatttccgt cgtcctgatt       300
     tcgcaactca gttttgcgct ctgtgtcgac gtctttggct ggttcggttt accgaaagtc       360
     gagttgtcgt tcggtcaaat catcggtctg gccgtcatgc tcagcggcat ctttgtcctg       420
     aaacggtatc aggtcgcaga ggatacagaa gaagtggaag atgttaaagt catttcctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page