(data stored in ACNUC7421 zone)

EMBL: CP001022.PE4

CP001022.PE4         Location/Qualifiers
FT   CDS_pept        3506..4660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bsu:BSU00040 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59492"
FT                   /db_xref="GOA:B1YGB5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGB5"
FT                   /protein_id="ACB59492.1"
FT                   /translation="MRLDSVRLSHYRNYESLELSFSEKTNVLIGENAQGKTNLLEAIYV
FT                   LALAKSHRTTHDKELIQWDAETARVEGRIHKRRGSHSQEIAISSRGKKAKLNHLEQRRL
FT                   SDYVGALNIVLFAPEDLHIVKGSPQIRRRFLDMEIGQVSPVYLHELSQYLKVLKQRNAL
FT                   LKQLSMKGGDETFLDVLTEQMITLAVKIVQRRHHFIAQLEKWARPIHEGISRGQEQLVL
FT                   IYRSDTFSNDLLDVEGMTASYMQKFGKMKTNEIRRGVTLFGPHRDDFEMEVNGRNVQTY
FT                   GSQGQQRTAALSLKLAEIELIHEEVGEYPLLLLDDVLSELDDHRQTHLLDTMQQKVQTI
FT                   LTTTSVDGIAHETIKQAKLFHVKQGAVILEETSYKEIVGEKTDE"
     gtgcgactag attcggtccg actcagtcac taccgcaact atgagtcgtt ggaattatct        60
     ttttccgaaa agacgaatgt gctgattgga gagaatgcac aagggaagac aaacctcctt       120
     gaagccattt acgttctggc tcttgcaaag tcccaccgga cgacgcatga caaagaattg       180
     atccagtggg atgccgagac agcccgtgtc gaaggacgga ttcacaagag aagaggatca       240
     cattcgcagg aaatcgcgat ttcaagccgc ggtaaaaaag cgaagctaaa tcatctcgaa       300
     cagcgccggc tcagtgatta tgttggtgcg ttgaatatcg tgctgtttgc accggaagac       360
     ttacacatcg tcaaaggcag tccacaaatc agacgtcgct ttttggatat ggaaattggt       420
     caggtcagcc cggtctatct acatgaatta agtcagtatt taaaagtcct caaacaacgg       480
     aatgcattgc ttaagcagtt atcgatgaaa ggtggggacg agacgttcct cgatgtcttg       540
     acggagcaga tgattacgct tgccgttaaa atcgttcaac gccgtcatca cttcattgcc       600
     cagctcgaaa agtgggcacg tccgattcat gaaggaatca gtcgcggaca ggaacagctc       660
     gtccttattt accgttcgga tacatttagc aatgatttgc tcgatgttga aggaatgact       720
     gcttcttaca tgcagaagtt tggtaaaatg aagacaaacg aaatccgaag aggtgtgacg       780
     ttgttcggtc cgcaccggga tgacttcgaa atggaagtca acggtcggaa tgtccagact       840
     tatggttcac aaggacagca acgaacggca gcactctctt tgaaattagc agagattgaa       900
     ttgattcatg aagaagtggg ggaatatcca ttgctacttc tagacgatgt cttatccgag       960
     ctcgatgatc atcgtcaaac ccatttgctc gatacgatgc aacaaaaggt gcagaccatt      1020
     ctgacgacaa cgagtgtcga tggaatcgca catgaaacga tcaaacaggc gaagttgttc      1080
     cacgtgaaac agggggccgt cattttggaa gagacatcat acaaagaaat agtaggtgag      1140
     aaaaccgatg agtaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page