(data stored in ACNUC7421 zone)

EMBL: CP001022.PE401

CP001022.PE401       Location/Qualifiers
FT   CDS_pept        427223..427516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0407"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   son:SO_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59889"
FT                   /db_xref="GOA:B1YIK6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK6"
FT                   /protein_id="ACB59889.1"
FT                   /translation="MGEIIVNAVLTVKAGLADQVFPILSTVYKAAQNEPGCLRYTLHQS
FT                   IENEHQFMLYEVYRDEEALEAHIASDHYKAYREQIELYLEDRQVTKYVEMTF"
     atgggtgaaa tcatcgtcaa tgccgttctt acagtcaaag caggattagc cgatcaagtc        60
     tttccgattt taagcacagt ctacaaagca gcacaaaatg aaccgggttg cttgcgttat       120
     acattacatc aatcgattga aaatgaacat cagttcatgc tttatgaagt gtaccgggac       180
     gaagaggctc tggaagcgca tatcgcatct gatcattata aagcataccg ggaacaaatc       240
     gagttatacc tggaggatcg tcaagtgacg aagtacgtcg agatgacatt ctaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page