(data stored in ACNUC7421 zone)

EMBL: CP001022.PE404

CP001022.PE404       Location/Qualifiers
FT   CDS_pept        431125..431454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0410"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   bha:BH0686 chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59892"
FT                   /db_xref="GOA:B1YIK9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK9"
FT                   /protein_id="ACB59892.1"
FT                   /translation="MAKYWLSIILASFFEVGWVIGLKHATTPLEWAATVVSIIISFTVL
FT                   IKVCNHLPVGTVYAVFVGLGTAGTVVTDIVLFDQSASVIKLILIAVLLVGVIGLKLVSG
FT                   EGEKQ"
     atggcaaaat attggttaag catcattctg gcatcctttt ttgaagtcgg ctgggtcatc        60
     ggcttaaagc acgctacgac accacttgaa tgggcggcga ctgtggtcag tatcattatc       120
     agtttcacgg tgttaatcaa ggtctgtaat catctgccgg tcggaacggt ctatgccgtt       180
     ttcgtcggac tcggcacagc aggaacggtc gtgacggata tcgtcttgtt tgatcagtcc       240
     gcatccgtca tcaagttgat cttgatcgcg gtcttgctcg taggggtgat cggtttgaaa       300
     ttagtcagcg gggagggtga aaaacaatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page