(data stored in ACNUC7421 zone)

EMBL: CP001022.PE409

CP001022.PE409       Location/Qualifiers
FT   CDS_pept        complement(434764..435726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0415"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: aeh:Mlg_2042
FT                   diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59897"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL4"
FT                   /protein_id="ACB59897.1"
FT                   /translation="MWHPCAECTTTIRFIEAGSLHIQSPTPEVFSYSSFEQLEQILSST
FT                   LQIGDFPVSCRAKGSRLVTPVLAASVLLEQLKSRQAIDFIQNGVMTSHLQPIFNIQDNS
FT                   LFANEALLRAADQTIPMSPGLLFSTASKMGLHSRLDQRAREEAIRATHLVGGTQKTFIN
FT                   FLPSTIYNPEYCLRHTFEIVERYNVDPSRLVFEVVETEKIEDVNHLKHVFEQYKKQGIQ
FT                   VALDDVGAGFSTLDMLSLLQPDYVKIDRAFISNCDTVAENEAFLRKARHLTKEMGIQIL
FT                   AEGIERQEELELCRELGFDFGQGYLLGHPAPYSELAKAQ"
     atgtggcatc cttgcgccga atgtacaaca acaatccgat ttatcgaagc aggttcttta        60
     catattcaat cgccgacacc ggaagtattt tcttacagtt catttgagca gttggaacaa       120
     atccttagct ctacgttaca gattggggat tttccggttt cctgccgggc gaaaggatca       180
     cgtctcgtga cacctgtact tgcagcttct gttttgctcg aacagttgaa gagccgacaa       240
     gccattgatt tcattcaaaa tggagtcatg acgagtcatc tgcaacccat attcaatatc       300
     caggacaaca gcttattcgc aaacgaagct ttgctccggg ccgccgatca aacgattccg       360
     atgtctcccg gcctcctctt ttcgacggct tcaaaaatgg gacttcattc ccgcctcgat       420
     caacgggcgc gagaagaagc cattcgggca acacatttgg ttggaggaac acagaaaaca       480
     ttcattaatt tccttccttc aaccatctac aatccggaat attgcctgcg tcatacgttc       540
     gaaatcgtcg aacggtataa cgtcgatcca agccggctcg tgttcgaagt cgtcgaaacc       600
     gaaaaaatcg aagacgtcaa tcacttgaaa catgtcttcg aacaatataa aaaacagggc       660
     attcaagtcg cactggacga tgtcggtgcc ggcttctcga cgcttgatat gttgtcgtta       720
     ctccaaccgg attacgttaa aattgaccgc gccttcatct caaactgtga cacagtagca       780
     gaaaatgaag cgttcctgcg aaaagcacgt catttaacaa aagagatggg gattcaaatt       840
     cttgcagaag ggatcgaacg tcaggaagaa cttgagctct gccgcgaact tggatttgac       900
     ttcggtcaag gttatctgct cggtcaccct gccccttatt cggagctggc aaaagcacaa       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page