(data stored in ACNUC7421 zone)

EMBL: CP001022.PE410

CP001022.PE410       Location/Qualifiers
FT   CDS_pept        complement(435937..436209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0416"
FT                   /product="protein of unknown function DUF1294"
FT                   /note="PFAM: protein of unknown function DUF1294; KEGG:
FT                   ppu:PP_2863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59898"
FT                   /db_xref="GOA:B1YIW8"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIW8"
FT                   /protein_id="ACB59898.1"
FT                   /translation="MTIFSTIAAFYGIMTVVGFISMWRDKRKAQQHAWRTPEATLLTIA
FT                   FLGGALGTLLAMQLVRHKTRTAKFQLFVPLAILLHATLWIFWIRS"
     atgactattt tttcaactat cgctgccttt tacggcatca tgaccgttgt cggatttatc        60
     tcgatgtggc gggataaacg taaagcccag caacatgcct ggcggacacc ggaagccacc       120
     ttgttgacga ttgctttttt gggcggcgcg ctcgggacgc ttttagccat gcagctcgtc       180
     cggcataaaa cacggaccgc caaatttcaa ctcttcgtac cgcttgcgat tttactgcat       240
     gcgacgctgt ggattttttg gattcggtca taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page