(data stored in ACNUC7421 zone)

EMBL: CP001022.PE412

CP001022.PE412       Location/Qualifiers
FT   CDS_pept        complement(436956..437549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0418"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: cbe:Cbei_1896 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59900"
FT                   /db_xref="GOA:B1YIX0"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX0"
FT                   /protein_id="ACB59900.1"
FT                   /translation="MARRNRGGSKLPLIIGIAVVVLIAFLAIGQYNSLVNVEEDVSNKW
FT                   SQVDNQIKRRADLIPNLVETVKGVAGQEQKVYGDIAEAQAGLARAASTEQRIEADQQVT
FT                   SSLRGLIALQTTYPELKSSERFQSLMDTLEGTENRLGIARKDYNDAVTVYNKKRRSFPT
FT                   SLYASAFGFEKKPYYEISESDRENPTVDFNSDSK"
     atggctcgta gaaatcgtgg aggttccaag ttacctctca tcatcgggat tgcagtcgtc        60
     gtcctgattg cctttttagc aatcggacag tacaacagtc tcgtcaatgt cgaagaagat       120
     gtttcgaata agtggtcgca agtcgataat cagatcaaac gccgggcgga tttaattccg       180
     aatctcgtcg aaaccgtcaa aggggtcgcc ggtcaggaac aaaaagttta tggggatatc       240
     gccgaagcac aagccggtct tgcccgtgcc gcttcgacgg aacaacggat tgaagccgat       300
     caacaggtca cgtcttcact tcgcggattg attgcgttgc aaacgacata tccggaatta       360
     aaatcaagcg aacgattcca atcgttaatg gatacactag aaggcacgga aaaccgtttg       420
     ggtattgctc ggaaagatta taatgatgcc gtgaccgttt acaataaaaa acgtcgcagc       480
     ttcccgactt cgctttatgc ttcggcattt ggtttcgaga aaaaaccata ttatgaaatc       540
     tcggaaagtg accgtgaaaa tccaacggtc gacttcaata gtgactcgaa atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page