(data stored in ACNUC7421 zone)

EMBL: CP001022.PE414

CP001022.PE414       Location/Qualifiers
FT   CDS_pept        438667..440790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0420"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: bca:BCE_0663 heavy metal-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59902"
FT                   /db_xref="GOA:B1YIX2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX2"
FT                   /protein_id="ACB59902.1"
FT                   /translation="MEAKTERLKITGIDCANCAAKVERGVASVAGIEQADLDFAGQKLY
FT                   LTYEKGAASDDTYQAVVERIQQLEPDVHLVRTASTEAVDPREHAGHDHSHPHDHGPFLN
FT                   RTKKIQYSVGMISFISAFFVPGSIDLLFFAVAYFLIGWDVLQTAVRNIRHGQVFDENFL
FT                   MVIATVGAFLIGEYPEAVAVMLFYQVGEFFQHRAVDQSRKSIAALMDIRPDIATLEDGR
FT                   RVSPEQVNIGQRIVVRAGEKIPLDGTVLTGEAFIDTTALTGESVPRRVRPTEPVLAGTI
FT                   NTDGHLLIQVDRPYNESTVAKILDLVENASRHKAPTEKFITRFARVYTPIVVLVATLLA
FT                   VVPPLVVTGATWSDWIYRALVFLVISCPCALVISIPLGFFSGIGAASKRGILVKGGNHL
FT                   EALQQLDTVVFDKTGTLTEGVFEVVELKAVHGSEDELLRVAATVEQHSNHPIAKSIQRM
FT                   YARHASVSTAVQDYQEVAGSGVTGRFGTDQIQAGNARWFKELGLTPLDQTEDGTYVHVA
FT                   QNDSYLGFIRIADRIKDTTVEALDGLKALGIRQTIMLTGDRRETAEQIGRQIGITQVKA
FT                   ELLPDQKVEQLEAILYQANGRVAFVGDGINDAPVLTRADVGIAMGGLGSDVAIEAADVV
FT                   LMTDEPKQLVEAIRIARATRRIVYQNIAFALGIKGVFLLLGAFGVATMWEAVFADVGVT
FT                   VLAVLNAMRILRK"
     atggaagcga aaacagaacg tctgaaaatt acaggaattg attgtgccaa ctgtgcggcg        60
     aaggtggaac ggggtgtcgc gagcgtggca ggcatcgaac aagctgattt ggattttgcc       120
     ggtcagaaac tctatctgac atatgaaaag ggcgctgcaa gcgacgatac gtatcaggca       180
     gtcgtcgaac ggattcagca acttgaaccg gatgtccacc tcgtccggac ggcgtccaca       240
     gaagccgtcg atccgcgtga acacgcggga catgaccaca gccatccgca cgatcatggt       300
     ccatttttga accgtacgaa aaaaatacaa tacagtgtcg gtatgatctc gttcatcagt       360
     gctttttttg ttccgggatc aattgacctt ctattttttg cggttgccta ttttttaatc       420
     ggttgggatg tccttcaaac cgctgtcaga aatatccggc atggtcaggt gtttgacgag       480
     aacttcttga tggtcattgc gacggtcggt gcttttttaa tcggagagta tccggaagcc       540
     gtcgctgtca tgttgtttta tcaagtcggg gagtttttcc aacaccgtgc tgtcgatcag       600
     tcgcggaaat cgattgctgc gctgatggat atccggccag atattgcgac gcttgaggat       660
     ggacgacgtg tgagtccgga acaggtcaat atcggtcaac ggatcgttgt ccgggcaggg       720
     gagaagattc cactcgatgg aacggttctg acaggagaag cgttcattga tacgaccgcg       780
     ttgacggggg aatccgtccc gcggcgtgtc cgtccgaccg agccggtttt agccggaaca       840
     atcaacactg acggtcatct gttgattcaa gtagaccggc cgtacaatga gtcgaccgtc       900
     gctaaaattc tcgatttagt ggaaaatgcg tcacgtcata aagcaccgac ggaaaaattc       960
     atcacacgat ttgcacgggt ttacacaccg attgtcgttc tggtggcaac actgcttgcc      1020
     gtcgtgccgc cgcttgtcgt gacgggagcg acgtggagtg actggattta ccgggcactg      1080
     gtgttccttg tcatcagttg tccgtgtgcg ctcgtcattt caattccgct cggcttcttt      1140
     agcggaatcg gcgccgcttc gaaacgcggt attctcgtca aaggcggaaa tcatctcgaa      1200
     gcgttacaac aactcgatac ggtcgtcttc gataaaacgg gaacgttgac ggaaggggtg      1260
     tttgaagtcg tcgaactgaa agccgtgcat ggatcggaag acgaactgct tcgcgtcgca      1320
     gcgaccgttg agcaacattc caatcatccg attgctaaat ccattcagcg gatgtatgcc      1380
     cggcacgctt ctgtttcgac cgctgttcaa gactatcagg aagtagccgg ttccggcgtc      1440
     accggacggt tcggcacgga tcagattcag gccggaaatg cccggtggtt caaagaactc      1500
     ggcttgacgc cgctcgatca gaccgaagac gggacctacg tacatgtggc ccaaaatgac      1560
     agctaccttg gatttatccg gattgccgac cgtattaaag acacgacggt agaagcgttg      1620
     gacgggctga aagcactcgg aattcgtcag acaatcatgt tgaccggcga ccgccgggaa      1680
     acggcggagc agatcgggcg acaaatcggg ataacgcaag tgaaggcgga actgttaccg      1740
     gatcaaaaag tggaacaatt agaagctatc ttgtatcaag cgaacggccg ggtcgcgttt      1800
     gtcggcgacg gaatcaacga tgctcccgtg ttgacgcggg cggatgtcgg gattgcgatg      1860
     ggtggactcg gaagtgatgt cgcaattgaa gcggcagacg tcgtcctgat gacggatgaa      1920
     ccgaaacagc tcgtcgaagc gattcggatt gcccgggcga cacgccggat cgtttatcag      1980
     aacattgcat ttgcacttgg tatcaaaggc gtgttcttat tgcttggcgc ctttggtgtt      2040
     gcgacgatgt gggaagctgt ttttgccgat gttggtgtaa cggtgctcgc ggtcttaaac      2100
     gcgatgcgga ttttacgaaa ataa                                             2124
//

If you have problems or comments...

PBIL Back to PBIL home page