(data stored in ACNUC7421 zone)

EMBL: CP001022.PE416

CP001022.PE416       Location/Qualifiers
FT   CDS_pept        complement(441736..442065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0422"
FT                   /product="YolD-like protein"
FT                   /note="PFAM: YolD-like protein; KEGG: oih:OB2266
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59904"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX4"
FT                   /protein_id="ACB59904.1"
FT                   /translation="MTRYRDRGNLKWLPFLMPEHIQLLKAYYLETHQIDFPVIDEQLQY
FT                   PWQFLLEQALIEGIELEITYYSERGYVTTSGFIEQVHRERAYLVLRGSSRIEIPLGRII
FT                   RIENG"
     atgacacgtt atcgtgaccg cggaaatctc aaatggcttc cctttttgat gccggaacac        60
     attcaactcc tcaaagccta ctatcttgaa acacatcaaa tcgattttcc tgtcatcgat       120
     gaacaattgc agtatccttg gcagttctta ctcgaacaag cattaataga aggaatcgag       180
     ctcgaaatca cgtattatag tgaaagaggc tatgtcacga catccggatt catcgagcag       240
     gttcaccgtg agcgcgcgta ccttgttttg cgcgggtcct cacggattga aattccgctc       300
     ggacgaatca tccggatcga aaacgggtag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page